KEGG   Desulfovibrio alaskensis: Dde_3062Help
Entry
Dde_3062          CDS       T00294                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
dde  Desulfovibrio alaskensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Dde_3062
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dde_3062
  Lipid metabolism
   00071 Fatty acid degradation
    Dde_3062
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dde_3062
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dde_3062
   00626 Naphthalene degradation
    Dde_3062
Enzymes [BR:dde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dde_3062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3054413..3055591
Genome map
AA seq 392 aa AA seqDB search
MMHFNFHMPTRLIFGQGTLRRLAGEPLPGTRALVVVSAGGSMKKLGYLEQVRSLLAQNGC
ESEVYDRIQPNPVKEHVMEGAALARSARCDFIVGLGGGSSIDSAKSIALMAANPGDYWDY
MGGTGGGKTPPEPALPVIAIPTTAGTGTEADPWTVITNTATREKIGWGNDSTFPRFSIID
PMLMLSVPPSVTAYTGMDAFFHATEAYLATCNQPSSDLLAQQAIHLISTFLPQCVHDGSN
PETRTMLAWASTAAGICESLSSCISHHSLEHALSAFYPDIPHGAGLVMLSEAYFSHLARF
VPERMTHLGYFMGVDVDSLPEERQPEAFVHALAKLKADCGLAELKMSDFGVKRSDLPALA
RNARESMGGLFHVTPVELDEAAVLDIFEKAYR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgatgcattttaattttcacatgcccacacggcttattttcggacaaggcaccctgcgc
cggctggccggagaacccctgccgggcaccagagcactggttgtggtcagcgccggtggt
tccatgaaaaagctcgggtatctggaacaggtacgctcgctgctggcgcaaaacggctgc
gaaagcgaagtgtatgatcgcatacagccaaaccctgtcaaagagcatgtgatggaagga
gccgcgctggcacgctcggcccgctgcgatttcatcgtcgggctgggaggcggcagcagc
atcgattccgcaaaatccatcgccctcatggccgcaaaccccggagactactgggactac
atgggcggcaccggcggcggcaaaacaccgccggaaccggcgctgcctgtcattgccatt
cccaccaccgcgggtaccggcacagaggccgacccgtggacagtcatcaccaacaccgcc
acgcgtgaaaaaataggctggggcaacgactccacgtttccccgtttttccatcatcgac
cccatgctgatgctcagcgtaccgcccagtgtcaccgcctataccggcatggacgccttt
ttccacgccacagaagcatatctggccacctgcaaccagccctccagcgacctgctggcc
cagcaggccatccatcttatctcgacatttctgccgcagtgcgtgcacgacggaagcaac
cccgaaacacgcaccatgcttgcgtgggcatccacagccgccggcatctgcgaatcactg
tcgtcgtgcatatcgcaccattcgcttgagcatgcgctttcggcattttatcccgacatt
ccgcatggtgccggactggtcatgctgtccgaagcgtacttcagccatctggccagattt
gttcccgaaagaatgacgcatctgggctatttcatgggtgtagatgtggacagcctgccc
gaagaacgtcagcctgaggcatttgttcacgcgctggcaaagctgaaagccgactgcggg
ctggcagaactgaaaatgtctgatttcggtgtgaagcgctccgacctgcccgcgcttgcc
cgtaatgcacgcgaaagcatgggcggactttttcatgtgacgccggtggaactggacgaa
gccgctgtccttgatattttcgaaaaagcctacagataa

DBGET integrated database retrieval system