KEGG   Desulfovibrio alaskensis: Dde_3071Help
Entry
Dde_3071          CDS       T00294                                 

Definition
(GenBank) polar amino acid ABC transporter, inner membrane subunit
  KO
K02029  
polar amino acid transport system permease protein
Organism
dde  Desulfovibrio alaskensis
Module
Putative polar amino acid transport system
Brite
Transporters [BR:dde02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    Dde_3071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3062244..3063173)
Genome map
AA seq 309 aa AA seqDB search
MNPMPAAVPEERAVECDGSMPRDAAAKGRCRVRLPVRIWRAVTDARRPWAVDMMLYLAVM
TGVVWFTLRGTEQLGYHWQWHRALRYLADTRGGWHAGPLLQGLLVTFKVSAVSLVLAAVI
GLAAVLLRLSRSVVGRALAVCYLETVRNTPLLIQLFVMYFVVAPLTGMDRFFSAVLALSL
FEGAYISEIIRAGIQAVPAGQWEAARSLGLTRAATYRKVVLPQALGHVLPPLTGQMVTLV
KDSALVSTIAIYDLTMQAQAIIAETFLVFEIWFMVAAMYLVVTLSLSLLAQRLECRLRTG
SKACRKAAA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgatgccggccgccgtgccggaggagcgcgccgtggaatgtgacggcagcatg
ccgcgcgatgccgctgcgaagggcagatgcagggtgcggctgccggtacgcatctggcgc
gcggtgacggatgcacggcgtccgtgggcggtggatatgatgctgtatcttgccgtcatg
accggggtggtgtggtttacgctgcgcggtacggaacagctgggctaccactggcagtgg
caccgtgccctgcgctatcttgcggacacgcgcggcggatggcatgccggtccgctgctg
caggggctgctggtcaccttcaaggtatcggccgtcagcctggttctggcagccgtcata
gggcttgccgcggtgctgctgcggctttcgcgttctgtggtggggcgggctcttgctgtc
tgttatcttgagactgtccgcaatacgccgctgctcattcagctttttgtcatgtacttt
gtggtggccccgctgacgggcatggacaggtttttttccgccgtgctcgcgctcagcctg
tttgaaggcgcctatatatcggaaataatccgtgcgggcatacaggctgtacctgccggt
cagtgggaggctgcacgcagtctggggctgacccgcgcggccacttaccgcaaggttgtg
ctgccgcaggcgctggggcatgtgctgccgccgcttaccgggcagatggtcacactggtt
aaagattcggcgctggtaagcaccattgccatttacgacctgaccatgcaggcgcaggcc
attattgcagaaacatttctggtttttgaaatctggtttatggtggctgccatgtatctt
gtcgttacgctcagtctttcactgctggcacagcgccttgagtgccggctgagaaccgga
tcaaaggcatgtcgcaaggctgccgcataa

DBGET integrated database retrieval system