KEGG   Desulfovibrio alaskensis: Dde_3072Help
Entry
Dde_3072          CDS       T00294                                 

Definition
(GenBank) protein of unknown function UPF0047
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0047
Motif
Other DBs
NCBI-ProteinID: ABB39866
JGI: Dde_3072
UniProt: Q30WT0
Position
complement(3063189..3063605)
Genome map
AA seq 138 aa AA seqDB search
MKSYRKELWFEVPARRAFVNITEEVEACLHESGIREGLCLVNAMHITASVFINDDEAGLH
SDYDEWLERLAPHAPVSQYRHNVGEDNADAHMKRQIMGREVVVAVTQGRLDFGTWERIFY
GEFDGRRKKRALVKIIGE
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgtacagaaaggaactgtggtttgaagtacctgcgcgcagagcctttgtgaat
ataacggaagaggtggaagcctgcctgcatgaaagcggcatccgtgaaggtctgtgcctt
gtcaacgccatgcatattacggccagcgtgttcataaatgatgacgaagccgggctgcat
agcgattatgacgaatggctggagcgtctggcaccccatgcgcctgtgtcgcagtacaga
cacaacgtgggcgaagacaacgccgatgcacacatgaaacggcagataatgggacgcgaa
gtagtggtggcagtgacacagggcagactcgacttcggcacgtgggagcgcatcttttac
ggtgagttcgacggccgccgtaaaaaacgcgcactggttaaaattatcggggagtga

DBGET integrated database retrieval system