KEGG   Desulfovibrio alaskensis: Dde_3079Help
Entry
Dde_3079          CDS       T00294                                 

Definition
(GenBank) cysteine desulfurase NifS
  KO
K04487  
cysteine desulfurase [EC:2.8.1.7]
Organism
dde  Desulfovibrio alaskensis
Pathway
Thiamine metabolism
Metabolic pathways
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Dde_3079
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    Dde_3079
Enzymes [BR:dde01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     Dde_3079
Transfer RNA biogenesis [BR:dde03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    Dde_3079
 Prokaryotic Type
    Dde_3079
Mitochondrial biogenesis [BR:dde03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    Dde_3079
Prokaryotic defense system [BR:dde02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   Dde_3079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3068898..3070088
Genome map
AA seq 396 aa AA seqDB search
MRTIYMDNNATTAVDPAVLDEMLPYLKDLYGNPSSMHTFGGQVGRQVAEARERVARALGA
QPEEILFTSCGTESDNTAIMSALQAQPEKKHIITTRVEHPAVLNLVQHLEKKGYEATYLS
VDEKGRLDLDELRGALRKDTAIVSVMYANNETGTIFPIKEIAAIVKEKGALFHTDAVQAV
GKLHINVQEVPVDFLALSGHKLHAPKGVGALYVRRGTPYRPFLRGGHQERGRRAGTENVA
GIIALGKACELASLNMETERTTVKALRDRLENGLLNAIPEAIINGDTDNRLPNTTNIAFK
YVEGEAILLLMDGHGICASSGSACTSGSLEPSHVLRAMGVPFTYAHGSIRFSLSRFNTQA
DVDYVVDELPRIIARLREISPYRSGEDAQAKPACTC
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaccatatatatggacaacaacgccaccaccgccgttgaccccgccgtgctggac
gaaatgctgccgtacctgaaagacctgtacggcaacccttccagcatgcacaccttcggc
gggcaggtaggccgtcaggtggccgaggcccgcgaacgcgtggcgcgtgcgctgggcgcc
cagcccgaagaaattctcttcacctcgtgcggcaccgaaagcgacaacactgccatcatg
tccgccctgcaggcccagcctgaaaaaaaacatatcatcaccacccgcgtggaacacccc
gctgtgcttaatctggtacagcatctggaaaaaaaggggtatgaagccacgtatctgagt
gtggatgaaaaaggacgtcttgatctggatgagctgcgcggtgccctgcgcaaagacacg
gccatcgtttccgtgatgtacgcaaacaatgagaccggcaccatttttcccatcaaggaa
attgcagccatcgtcaaggaaaagggcgcgctttttcacacagacgcagtgcaggccgtc
ggcaaactgcatataaacgtgcaggaagtgcctgtggatttccttgcgctttccggccac
aagctgcacgcccccaaaggtgtgggagcgctgtacgtgcgccgcggcactccgtaccgg
ccttttctgcggggcggacatcaggaacgcggccgccgtgccggcacggagaatgtggcc
ggcatcattgcgctgggcaaagcctgcgagctggcttccctgaatatggaaaccgaacgc
accaccgtcaaggcgctgcgcgacaggctggagaacggcctgctcaatgccatacccgaa
gccatcatcaacggtgatacggacaacagactgcccaatacaaccaatatcgccttcaaa
tatgtcgaaggcgaagccattctgctgctgatggacggacacggcatatgtgccagctcc
ggttcggcatgcacttcaggcagccttgagccttcgcacgtactgcgtgccatgggagtg
ccgttcacctatgcccacggctccatccggttcagcctgagccggttcaacacacaggcg
gatgtggactacgtggtggacgaactgccgcgcatcatcgcccgtctgcgtgaaatatcg
ccctaccgcagcggtgaagacgcgcaggcaaagcctgcgtgtacctgctga

DBGET integrated database retrieval system