KEGG   Desulfovibrio alaskensis: Dde_3087Help
Entry
Dde_3087          CDS       T00294                                 

Definition
(GenBank) diguanylate cyclase
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF OGG_N
Motif
Other DBs
NCBI-ProteinID: ABB39881
JGI: Dde_3087
UniProt: Q30WR5
Position
3075451..3076536
Genome map
AA seq 361 aa AA seqDB search
MKQHSETNTVRFTCDRNGVIRHVVSDNAGLFAGIDLPLHINDLTTASAQKRYHAFLDTLT
ADGFGLCDSLVLRGRTGVRQFAVFGVCKGDCFHMIALQSSPHITNIFSELIHMLNEQGVL
LRATQKKAAEARSTGSDNVQLLEDYMIINNELSRNKRELAIRHEQLKKAFSDIEELSRTD
PLTGACNRRKVIEFLSAEIDRSKRYGTPLSILSLDIDRFKAINDTYGHAAGDDALIAFCR
VCRQQLRKTDLFGRTGGEEFVAVLPHAACRDAQISAERIRRHVEQIHITYNNACVRFTVS
IGIAVHEAGENTDTLLRRADAALYRAKTAGRNTVSVAEKSPVMPAETPHGHSPEQPAAGH
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcattcagaaaccaatacggtacgcttcacctgcgaccgcaacggcgttatc
aggcacgttgtctcggacaatgcaggcctgtttgccggcatagacctgccattgcatatc
aacgacctgaccacagcatcagcacaaaaacgctaccacgcctttctggacacgctgacc
gcagatggattcggcctgtgcgattctcttgttctgcgcggcagaacaggtgttcggcag
tttgccgtctttggtgtctgcaaaggcgactgttttcatatgatcgcgctgcaatcgtcc
ccgcatattacaaacattttcagcgagttaatacatatgctgaatgaacagggggtgctg
ctgcgggcaacgcaaaaaaaggctgcggaagcccgcagtacgggcagcgacaacgtgcag
ctgcttgaagactacatgataataaacaacgagctttcgcggaacaaacgcgagctggca
atcagacacgaacagctgaaaaaagccttcagcgacattgaggaactaagccgcaccgac
ccgctgaccggagcctgcaaccgccgcaaggtcattgaatttctgtcagcggaaatcgac
cgcagcaaacgttacggcacaccgctgtccatactgagccttgatatagaccgattcaag
gccatcaatgacacttacgggcacgctgccggagacgacgcgcttattgcattctgcaga
gtatgcaggcagcagctcagaaaaacagaccttttcggcagaacaggcggcgaagagttt
gtcgccgttcttccccatgccgcctgtcgcgacgcacaaatctcggcagagcgtatccgc
cgccatgttgaacagatacacattacgtataacaacgcatgcgtgcgttttacagtcagc
atcggcatagccgttcacgaggcaggggaaaataccgatacgctgctgcgcagggccgat
gccgcgctttacagggctaaaacagcaggccgcaacacagtcagcgtggcagaaaaatct
ccggtaatgcccgcagaaactccgcacgggcacagcccggaacagcccgctgccggacat
aaataa

DBGET integrated database retrieval system