KEGG   Desulfovibrio alaskensis: Dde_3091Help
Entry
Dde_3091          CDS       T00294                                 

Definition
(GenBank) heat shock protein Hsp20
  KO
K13993  
HSP20 family protein
Organism
dde  Desulfovibrio alaskensis
Brite
Chaperones and folding catalysts [BR:dde03110]
 Heat shock proteins
  HSP20
   Dde_3091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3081172..3081540)
Genome map
AA seq 122 aa AA seqDB search
MTTCQQKVQNPRRPRVRPAADLVEREDGFYLYLDMPGVERQELIVDIDGSELTVHALSRF
GCAAGERIHAFEFGDVEYYAQFTLSDMVDRAATAARLADGVLTIYMPKQQKVTPRRIRIE
VL
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgacaacatgccagcagaaagtccagaatcccagacgtccccgtgtgcgtcccgcagct
gatcttgtggagcgtgaagacggcttttacctgtatcttgacatgcccggcgtggaaaga
caggaactgatcgtggatattgacggcagcgagctgacggtgcatgccctcagccggttc
ggctgtgcagcaggcgagcgcatccatgcgttcgagttcggtgatgtggaatattacgcc
cagttcactctttcggacatggtggacagggcggccacggcagcgcgtcttgccgacggt
gttctgacgatttatatgcccaaacagcagaaggtcacccccagacgcattcgtatcgaa
gtgctgtag

DBGET integrated database retrieval system