KEGG   Desulfovibrio alaskensis: Dde_3096Help
Entry
Dde_3096          CDS       T00294                                 

Definition
(GenBank) PAS sensor protein
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg PAS_8 PAS PAS_9
Motif
Other DBs
NCBI-ProteinID: ABB39890
JGI: Dde_3096
UniProt: Q30WQ6
Position
3084766..3086442
Genome map
AA seq 558 aa AA seqDB search
MNTQQRRLKRGTFREQPLAQREEAEFRSLFENAAAGLFRKSRSGGFLLVNTALARMFGYP
TPDAFLAESKEAGHSLFADPQAFAAMVHKLLTHGVVNNAELRIIPRAPEGARPAAAAEWI
AVTARAVYTSKGSIRHFEGTVTDITRCKTARMRAAQLQEQLEQARSLECAGVLARALAED
IGGLLEPIVQQTQSALNTLPAHSPAHTALDQALTASTEARGQLYRMLEFCRELEPPQVPV
SFTAVVKECLRTLRGKNQDEKDGEAVPVKITADLDAREDVVKGNARLLRRAVCALVKYAA
DSCSGRTGPAMTLRLRTIDMETAAAAAHPPHTCTLPAGRHICLTFSGSGAHALPQGCTAC
PPWSTHGKPSLAMVQGIVKLHNGILCQGPDEGGVATLCLYLPALGVADSARTAAGPAPRL
GSERILVVDTDHSERNQWRALLGPLGYRMETRPGPVEGLRLFMESPESFDLVITAYAMPQ
LNGLEFARTLTGIRPDIPVALCLSAHDTVTPDSACAAGACRLARKPLDGAARTRLVELML
SRNTDKTAGQRSWPRFSS
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgaatacacagcagcgccgcctgaaacgcggcacattccgcgaacagccgctcgcccag
cgggaagaagccgaattccgcagcctgtttgaaaacgccgccgccggtctcttccgcaaa
tcccgctccggcggctttctgctggtcaacacggcactggcccgcatgttcggctatccc
acgcccgatgcttttctggccgaaagcaaagaagcgggacacagcctgtttgccgaccct
caggcctttgccgcaatggtgcacaagctgctgacccacggtgtggtcaacaacgcggaa
ctgcgtatcattccgcgcgcgcccgaaggcgcccgccctgccgccgccgcagaatggata
gccgtcaccgcgcgtgccgtatacacatcaaaaggcagcatcagacactttgaaggtact
gttaccgacatcacccgatgcaagaccgcccgcatgcgcgccgcgcagctgcaggaacag
ctggagcaggcacgttctctcgagtgcgccggggttctggcccgcgcactggccgaagac
ataggaggtctgcttgaacccatcgtacagcagacccagtcggcactgaataccctgccc
gcccacagccccgcacacaccgcactggatcaggcgctcacggcttccaccgaagcgcgc
gggcagctgtaccgcatgcttgaattctgccgcgaactggagccgcctcaggtgccggta
tcctttaccgcagtggtcaaagaatgcctgcgcacactgcgtggaaaaaatcaggatgaa
aaagacggcgaagccgtacccgtaaaaataaccgccgatctagatgcccgggaagatgtg
gtgaaaggcaatgcacgcctgctgcgccgtgccgtgtgcgctctggtgaaatatgcggcg
gacagctgttccggccggaccggaccggccatgacgctgcggctgcgcaccatcgatatg
gaaacagccgcggcagctgctcacccgccgcacacgtgcacactgcctgccggccggcat
atctgcctgacattcagcggcagcggagcccacgctttgccgcagggctgcaccgcctgc
cccccgtggagcacgcacggcaagccctcgctggccatggtgcagggcatagtaaagctg
cataacggcattctgtgccagggaccggatgaaggcggcgtggccacgttatgtctgtat
ctgcctgcactgggcgtggcggactcggcgcgcacagctgccggaccggctccgcggctg
ggcagcgaacggattctggtggtggacacagaccattcggaacgcaatcagtggcgtgca
ctgctcggcccgctgggataccgcatggaaacccgccccggtccggttgaggggctgcgc
cttttcatggaatcgcccgaatcttttgatcttgtaatcacagcatatgccatgccccag
ctgaacggactggaatttgcccgcacgctgaccggcatacggccggatattcccgtggcg
ctgtgcctgtcagcgcacgatacggtaacacccgattcggcctgcgcggccggagcgtgc
agactggcgcgcaaaccgctggacggagccgcccgcacacgcctcgtcgagcttatgctc
tcccgcaacaccgacaagacggcaggacaacgctcatggcccagattctcctcgtag

DBGET integrated database retrieval system