KEGG   Desulfovibrio alaskensis: Dde_3097Help
Entry
Dde_3097          CDS       T00294                                 

Definition
(GenBank) putative two component, sigma54 specific, transcriptional regulator
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_activat Sigma54_activ_2 Response_reg AAA_5 Mg_chelatase AAA AAA_16 HTH_8 AAA_2 AAA_22 HTH_17 IstB_IS21 T2SSE TsaE
Motif
Other DBs
NCBI-ProteinID: ABB39891
JGI: Dde_3097
UniProt: Q30WQ5
Position
3086421..3088028
Genome map
AA seq 535 aa AA seqDB search
MAQILLVDADSGFAHMLGAIIEGLGHRVHHAASLREGRALAAAAETDVVYLHVQLPDGSG
TTAVESFRSAPGRPEVVLLTDHGDPDTAEEAIRMGVWEYVEKSSPADRIILPLLRALDYR
GRRPSRRSTASLKRDDIIGSSRALQKCLDTVSEAAFSDASVLLFGETGAGKEVFARAIHD
NSHRAGGPFVAVDCASLTRTLAGSILFGHRKGAFTGAEQNKDGLVLQAHRGTLFLDEVGE
LPLSMQKLFLRVLQEHRFRPVGGRNEVTSDFRLIAATNRDLEKMVSQGTFRSDLLYRMRT
IVMHLPPLRSRTEDITELADHYLQRMCGKYGVPHKSMAPDLQETLRAYAWPGNVRELIHT
LERAVLAAQDEPRLFARHLPDHVRISTARAALQQRRTDSTAAAQPSRDEDTASGAPESRP
QAPRPCHTCGTLPESYGTPAVQPESTGQGLPHLHDTAGHNAAVPQEKHPLSPDHSPLPPF
FTFRDNMFRDYLRELLRRTDNDIAAACAMSGLSRSYLYDLLRRHGLRNGGTTSGS
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcccagattctcctcgtagacgcagactcaggttttgcccacatgctgggtgccatc
atagagggactggggcacagggtacaccacgccgcatcgctcagggagggacgagccctt
gccgctgcggccgaaaccgatgtggtgtatctgcatgttcaactgcccgacggcagcggt
acaaccgcggtggaatcgttccggtcggcccccggccgtccggaggtggtgctgctgaca
gaccacggcgaccccgacaccgcggaagaagcaatccgcatgggagtctgggaatatgtg
gaaaaaagcagtccggctgacaggataattctgcctctgctgcgtgcgcttgactacagg
ggcagacggccttcgcgacgcagtacggccagcctcaagcgcgatgacatcatcggcagc
agccgtgccctgcaaaaatgccttgataccgtctcggaagctgccttcagcgatgcatca
gtgttgcttttcggcgaaacgggcgcaggcaaggaagtatttgcacgcgccattcacgac
aacagccaccgtgccggcggtccctttgtggccgtggactgcgcatcgctcacccgtacg
ctggcgggcagcatactcttcggccaccgcaaaggcgcctttaccggtgcggaacaaaac
aaggacggtctggtgctgcaggcgcaccggggcacactctttctggatgaggtgggcgaa
ctgcctctttccatgcagaagctctttctgcgggtgcttcaggaacaccgcttccggccg
gtaggcggcagaaacgaggtgaccagcgatttccgtcttatcgccgcaaccaaccgggac
cttgaaaaaatggtgtcgcagggcacattccgttccgaccttttgtaccgcatgcgcacc
attgtcatgcatctgccgcctctgcgcagccgcaccgaagacattaccgaacttgccgac
cactacctgcaacgcatgtgcggcaaatacggcgttccgcacaaaagcatggcccccgac
ctgcaggaaacgctgcgcgcctatgcctggccgggcaacgtccgggagcttatccacacg
ctggaacgtgccgtacttgccgcacaggatgaaccacggctctttgcccgccacctgcct
gaccatgtgcgcataagcaccgcgcgggcggctttgcagcaacgcagaacagacagcacc
gccgctgcgcagccgtcccgtgacgaagacaccgcatccggtgcacccgaaagccgcccg
caggcaccgcggccgtgtcatacctgcggcaccctgccggaatcttacggcacgcccgcc
gtacaacctgagtccacaggccaaggcctgccgcacctgcacgacactgccggacacaat
gccgccgtcccacaggaaaaacaccctctttctccggaccacagccccctgccgccgttt
ttcaccttccgcgacaacatgttccgcgactacctgcgcgaactgctgcgccgtacagac
aacgacatcgccgcggcatgcgccatgtcgggactttcccgttcttacctgtatgacctg
ctgcggcgccacggcctgcgcaacggcggtacaacatccggcagctag

DBGET integrated database retrieval system