KEGG   Desulfovibrio alaskensis: Dde_3097Help
Entry
Dde_3097          CDS       T00294                                 

Definition
(GenBank) putative two component, sigma54 specific, transcriptional regulator
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3086421..3088028
Genome map
AA seq 535 aa AA seqDB search
MAQILLVDADSGFAHMLGAIIEGLGHRVHHAASLREGRALAAAAETDVVYLHVQLPDGSG
TTAVESFRSAPGRPEVVLLTDHGDPDTAEEAIRMGVWEYVEKSSPADRIILPLLRALDYR
GRRPSRRSTASLKRDDIIGSSRALQKCLDTVSEAAFSDASVLLFGETGAGKEVFARAIHD
NSHRAGGPFVAVDCASLTRTLAGSILFGHRKGAFTGAEQNKDGLVLQAHRGTLFLDEVGE
LPLSMQKLFLRVLQEHRFRPVGGRNEVTSDFRLIAATNRDLEKMVSQGTFRSDLLYRMRT
IVMHLPPLRSRTEDITELADHYLQRMCGKYGVPHKSMAPDLQETLRAYAWPGNVRELIHT
LERAVLAAQDEPRLFARHLPDHVRISTARAALQQRRTDSTAAAQPSRDEDTASGAPESRP
QAPRPCHTCGTLPESYGTPAVQPESTGQGLPHLHDTAGHNAAVPQEKHPLSPDHSPLPPF
FTFRDNMFRDYLRELLRRTDNDIAAACAMSGLSRSYLYDLLRRHGLRNGGTTSGS
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcccagattctcctcgtagacgcagactcaggttttgcccacatgctgggtgccatc
atagagggactggggcacagggtacaccacgccgcatcgctcagggagggacgagccctt
gccgctgcggccgaaaccgatgtggtgtatctgcatgttcaactgcccgacggcagcggt
acaaccgcggtggaatcgttccggtcggcccccggccgtccggaggtggtgctgctgaca
gaccacggcgaccccgacaccgcggaagaagcaatccgcatgggagtctgggaatatgtg
gaaaaaagcagtccggctgacaggataattctgcctctgctgcgtgcgcttgactacagg
ggcagacggccttcgcgacgcagtacggccagcctcaagcgcgatgacatcatcggcagc
agccgtgccctgcaaaaatgccttgataccgtctcggaagctgccttcagcgatgcatca
gtgttgcttttcggcgaaacgggcgcaggcaaggaagtatttgcacgcgccattcacgac
aacagccaccgtgccggcggtccctttgtggccgtggactgcgcatcgctcacccgtacg
ctggcgggcagcatactcttcggccaccgcaaaggcgcctttaccggtgcggaacaaaac
aaggacggtctggtgctgcaggcgcaccggggcacactctttctggatgaggtgggcgaa
ctgcctctttccatgcagaagctctttctgcgggtgcttcaggaacaccgcttccggccg
gtaggcggcagaaacgaggtgaccagcgatttccgtcttatcgccgcaaccaaccgggac
cttgaaaaaatggtgtcgcagggcacattccgttccgaccttttgtaccgcatgcgcacc
attgtcatgcatctgccgcctctgcgcagccgcaccgaagacattaccgaacttgccgac
cactacctgcaacgcatgtgcggcaaatacggcgttccgcacaaaagcatggcccccgac
ctgcaggaaacgctgcgcgcctatgcctggccgggcaacgtccgggagcttatccacacg
ctggaacgtgccgtacttgccgcacaggatgaaccacggctctttgcccgccacctgcct
gaccatgtgcgcataagcaccgcgcgggcggctttgcagcaacgcagaacagacagcacc
gccgctgcgcagccgtcccgtgacgaagacaccgcatccggtgcacccgaaagccgcccg
caggcaccgcggccgtgtcatacctgcggcaccctgccggaatcttacggcacgcccgcc
gtacaacctgagtccacaggccaaggcctgccgcacctgcacgacactgccggacacaat
gccgccgtcccacaggaaaaacaccctctttctccggaccacagccccctgccgccgttt
ttcaccttccgcgacaacatgttccgcgactacctgcgcgaactgctgcgccgtacagac
aacgacatcgccgcggcatgcgccatgtcgggactttcccgttcttacctgtatgacctg
ctgcggcgccacggcctgcgcaacggcggtacaacatccggcagctag

DBGET integrated database retrieval system