KEGG   Desulfovibrio alaskensis: Dde_3099Help
Entry
Dde_3099          CDS       T00294                                 

Definition
(GenBank) methylated-DNA/protein-cysteine methyltransferase
  KO
K07443  
methylated-DNA-protein-cysteine methyltransferase related protein
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3088591..3088908
Genome map
AA seq 105 aa AA seqDB search
MERTQFTVEVIRQIKSIPAGYVSTYGMIAAMAGNPRAARQVARVLHSCSARDALPWYRVI
NAGGNISLPRGGGYERQKALLQREGIVFDETDRVDLQRFMWTMPA
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
ttggaaagaacacagttcaccgttgaggtaatacgccagataaaaagcattccggcagga
tacgtgagcacgtacggaatgattgccgccatggcgggaaacccgcgggcagcacggcag
gtggccagagtgctgcatagctgttccgcccgtgacgctctgccgtggtaccgcgtcatc
aacgccggcgggaacatatcgctgccccgcggcggcgggtacgaacgtcagaaagccctg
ctgcagcgggagggcattgtctttgacgaaacagaccgcgtggacctgcagcgttttatg
tggacaatgccggcatga

DBGET integrated database retrieval system