KEGG   Desulfovibrio alaskensis: Dde_3101Help
Entry
Dde_3101          CDS       T00294                                 

Definition
(GenBank) PAS fold domain protein
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_sub_bind PAS_4 PAS
Motif
Other DBs
NCBI-ProteinID: ABB39895
JGI: Dde_3101
UniProt: Q30WQ1
Position
complement(3089981..3092254)
Genome map
AA seq 757 aa AA seqDB search
MKTRFIPSDRPAGNRLCVIFALAALFLVLLPAAAAAENGRVLVLNSYHRGFQWSDAEMSG
IESWFVDSDIKPQLHFEYMDSKRMAPDVATRHMFVLLREKYSRDYFDVLMAADDNAFELL
RAHRQTLFPGVPLVFCGVNLQHMPRGSMPERTTGVLERVDVEGTLSLALSMHPATRSVVF
VADGTTTGQRMLHAAREARRGFAGRVDFTELNNLPAPKLQEALRLLPSSSVVVLLSFLRD
RNGRVLTVEECVRLLTQASPVPVYGVGAQFIAAGLAGGTQLSGTEHGRQAARLAEQILRG
ADPSELSIIAETPVTAVLDYRQLSRFGVSLPDLPDGVIVRNLPQGSPSVWWYGAGLAAAA
AMALLFRHWRNRRCMPACEDSATALGGVLAAMQHMNDICLLLDTAGRIAAMNRPAEQASG
IDSHAAEGMLPEAVLPMLAGALEKLRRGLQHNDEFCLLQAEARMDNGLRRFDLEASSLLP
VAAGALLVLRDVTDRAVLEAAAVGVHRLSLVTRMVSGMCHGAKEPLSAVVQNAEELHEVL
FEDTEGNARAAARCGCSLSALRGYLGERDVPRRVGLLRAAGAELTGIVSRLPNAERRSPE
RPMPLKDVVDNALRLGRDDPRLREYGMGRVGWRIEADGADSVQIIRAADAELVVYEMITL
GLYALMSGEASPGGVLVQYGATPRGGRVVLTASGCSRPVDIAKLLRSERMFGGSGGEMSG
YEGFALATRIAEHRFGAPLKVESPENDVRIEFMLNQE
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccagattcataccttctgacaggccggcgggcaaccggctttgcgtcattttt
gctctggccgctctttttcttgtgctgctgcccgcggccgctgccgcagagaacgggcgg
gtgcttgtgctcaactcctaccacaggggcttccagtggtccgatgctgaaatgtcgggc
atcgaatcatggttcgttgattctgacatcaagccgcagctgcattttgaatatatggat
tccaaacggatggcgcccgatgtggccacccgtcatatgtttgtcctgctgcgcgaaaaa
tattccagagactatttcgacgtgctcatggcggccgatgacaacgcctttgaattgctg
cgggcgcaccgtcagacgctttttccgggggtgccgcttgttttttgcggggtaaacctg
cagcacatgccgcgcggcagcatgccggaacgcaccacgggagtgctggaaagggtggat
gtggagggtacgctttcgctggcgctttccatgcatccggccacccgcagcgtggtgttt
gtggccgacggcaccacgacggggcagcgcatgctgcatgccgcacgcgaggcacgcaga
ggctttgcgggacgggtggattttaccgagctgaacaacctgcctgcccccaagctgcag
gaagctctgcgcctgctgccttcatcgtctgtcgtggtgctgctcagttttctgcgcgac
cgcaacggcagggtgcttacggtggaagaatgcgtccggctgcttacgcaggcttctcct
gttcccgtgtacggagtgggagcgcagttcatcgccgcagggcttgcgggcggcacgcag
ctttcgggtaccgagcacgggaggcaggcggcacggctggcggagcagattctgcgcggg
gccgacccctcagagttgtccataattgcggaaacccctgtgacggcggtgcttgactac
cgacagctttcgcgtttcggggtgtctctgcccgacctgcccgatggtgtgatagtgcgt
aacctgccgcagggcagtccttctgtgtggtggtacggcgcggggctggcagctgctgcc
gccatggcgctgttgttcaggcactggcgcaaccggcggtgcatgcccgcctgcgaagat
tcggcaacggcccttggcggggtgctggcagccatgcagcatatgaacgatatctgtctg
ctgcttgataccgccggccgcatagcggccatgaaccgtccggcggaacaggcatcgggc
attgattcgcatgcggcggagggaatgctgcccgaggccgtgctgcccatgcttgccggt
gcgcttgaaaagctcaggcgcgggctgcagcacaatgacgaattttgcctgctgcaggcc
gaagcccgcatggataacgggctgcgccggtttgatctggaagcgtcgagcctgctgcct
gttgccgccggcgcgttgctggtgctgcgcgatgtgacagacagagccgttctggaggct
gcagccgtgggggtgcaccgtctttcgctggttaccagaatggtgtcgggcatgtgtcac
ggagcaaaggaaccgctttctgccgtggtgcagaatgccgaagagctgcacgaggtgctg
tttgaagacaccgagggtaatgccagagctgcagcgcgctgcgggtgcagcctgagtgcg
ctgcgcggttatctgggtgagcgggatgtgccccggcgtgtcggtctgctgcgggccgcc
ggtgcggagcttacgggcatagtgtccagactgcccaatgcggaacggcgcagtcctgaa
cggcccatgccgctcaaggatgtggtggacaacgccctgcgtctgggcagggacgacccg
cgcctgcgtgagtacggtatggggcgcgtgggctggcgcatcgaggcggacggcgcggac
tctgtgcagataatcagggcggcggatgcggaacttgtggtatatgagatgataaccctc
gggctgtatgccctgatgtcgggagaggcttctcccgggggggtgctggtgcagtacggg
gcaaccccccgcggagggcgggtggtgctgaccgcttcgggctgcagccgccccgtggat
atcgccaaactgctgcgcagcgagcgtatgttcggcggcagcggtggtgagatgagcgga
tacgaggggtttgctcttgccacgcgcattgcggagcacagatttggcgccccgctgaaa
gttgaatcgccggaaaacgatgtgcgcatcgaattcatgctgaatcaggagtag

DBGET integrated database retrieval system