KEGG   Desulfovibrio alaskensis: Dde_3105Help
Entry
Dde_3105          CDS       T00294                                 

Definition
(GenBank) Iron-chelate-transporting ATPase
  KO
K02013  
iron complex transport system ATP-binding protein [EC:3.6.3.34]
Organism
dde  Desulfovibrio alaskensis
Pathway
ABC transporters
Module
Iron complex transport system
Brite
KEGG Orthology (KO) [BR:dde00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Dde_3105
Enzymes [BR:dde01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.34  iron-chelate-transporting ATPase
     Dde_3105
Transporters [BR:dde02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    Dde_3105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3095828..3096655
Genome map
AA seq 275 aa AA seqDB search
MIRLRNATLGHGTTPVLHNISLHIRQGEMTGLLGPNGSGKTTLLLTLSGVLPPVSGEVLL
RTASAASEKDAVQFTPAAGLCARTRAKKMASVPQRPDIVPDMPVRSVVLMGRYPYISFLG
GYSAADNEAAENAMRQTATSQFASRPACRLSGGEFQRVLIARALAQAAPCLLLDEATSGL
DIARKVEIYDMLRRRHAQGLTVVAAIHDLNLAALYCDRLIFLKDGAVALDGPTRDVFTEA
NLCRIYETSVRVFRHPDCGLPQALFMPAHTQRKTP
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgatacgcctgcgcaatgccacactgggccacggtacaacgcccgtgctgcacaacatc
tccctgcatatcagacagggtgaaatgacaggtctgctcggccccaacggcagcggcaaa
acaaccctgctgctcaccctttccggagtgctgccgccggtcagcggcgaagtgctgctg
cgcaccgcctccgccgcatctgaaaaggatgcggtgcagttcactccggccgcggggctt
tgtgcccgcacccgcgcaaaaaaaatggcttcggtaccgcaacggcccgacatcgtccct
gacatgccggtgcgctccgtggtactcatgggacggtatccctatatatcctttctgggc
ggatacagcgccgcagacaacgaggccgcggaaaacgccatgcgccagacagccacatcg
cagtttgcctcacggccggcatgcaggctttccggcggagaattccagcgggtgctcata
gcacgggcgctggcacaagcggccccctgcctgctgctggacgaggccacatccggtctg
gacatagcccgcaaagtggaaatctacgacatgctgcgccgcagacatgcgcagggactc
acggtggtcgccgccattcatgaccttaatctggcggcactctactgtgaccggctgata
tttctgaaagacggagccgtggcgctggacggccccacccgcgacgtatttacagaagcc
aacctctgccggatatatgaaacctctgtccgcgtattccggcatccggactgcgggctg
ccgcaggctcttttcatgcccgcccacacgcagagaaaaacgccatga

DBGET integrated database retrieval system