KEGG   Desulfovibrio alaskensis: Dde_3111Help
Entry
Dde_3111          CDS       T00294                                 

Definition
(GenBank) L-serine ammonia-lyase
  KO
K01752  
L-serine dehydratase [EC:4.3.1.17]
Organism
dde  Desulfovibrio alaskensis
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dde_3111
   00270 Cysteine and methionine metabolism
    Dde_3111
Enzymes [BR:dde01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     Dde_3111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3100444..3101658
Genome map
AA seq 404 aa AA seqDB search
MDSITELYRIGSGPSSSHTMGPQNAARLFVEQHPEAARFRVTLYESLASTGKGHLTDRAV
TAALGEERCEIVWKPEERMPRHPNGMLFEAQDSNGNVTGSWKVYSVGGGAIMGEDEPRRQ
QQGVYPHPDLASVMALCEDKGITYWEYVARYEGETVWPFLKTIWQAMQQALERGLTAQGV
LPGSIGLRRQAWNYMSRTKLAHKSMHQTGKVTAYALAVAEENAAGGIIVTAPTCGSCGIV
PAVLYYLRETLKATEQDILRALATAGLFGNIIKHNASISGAEVGCQGEVGSACAMAAAAA
TQMMGGTVRQIEYAAEMGLEHHLGLTCDPVDGLVQIPCIERNACAATRALSRAQMAILSD
GMHRIPFDEVVAVMAQTGHDLPSLYRETARGGLAKVYAARPQKQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggacagcataacagagctttaccgcatcggctccggcccttcttccagccacaccatg
ggaccgcagaacgccgcacgtctttttgtggaacagcaccccgaagccgcacggttccgc
gttaccctgtatgaaagtctggcatccacaggcaaaggccacctgaccgaccgggccgtt
acagccgcactgggcgaagagcgctgtgaaatagtctggaaaccggaagaacgcatgccc
cggcatcccaacggcatgctgtttgaagcgcaggacagcaacggcaacgtaaccggcagc
tggaaagtgtacagcgtgggcggcggcgccatcatgggcgaagacgaaccccgcaggcag
cagcagggcgtctacccgcaccctgatctggcttcggtaatggccctgtgcgaagataag
ggcataacctactgggaatatgtggcccgttatgaaggcgaaaccgtatggccctttttg
aaaaccatatggcaggccatgcagcaggcgctggaacgcggtctgactgcgcagggagtt
ctgcccggttccatagggctgcgcaggcaggcatggaactatatgtcgcgcacaaagctg
gcgcacaaaagcatgcaccagaccggcaaggtgacggcctatgcgctggccgtggcagaa
gaaaacgcggcaggcggcatcatagtcacagcccccacatgcggttcatgcggcatcgtg
cccgccgtgctctattacctgcgcgaaacgctgaaagccaccgagcaggatattctgcgg
gctctggccacggcaggacttttcggcaacataatcaagcacaatgcgtccatttctggc
gcggaggttggctgtcagggcgaggtgggctctgcctgcgccatggcggcggccgccgcc
acccagatgatgggcggtacggtgcggcagatagaatacgctgccgaaatgggtctggag
caccatctggggctgacatgcgaccctgtggacgggctggtgcagattccctgtatagaa
cgtaacgcctgcgcggccacccgtgccctttcccgtgcgcagatggccatcctgtccgac
ggcatgcaccgcattccctttgacgaagtggtggccgtcatggcccagacaggtcacgac
ctgcccagcctgtatcgcgaaacagcccgcggcgggctggcaaaagtctatgccgcacgg
ccgcagaagcagtga

DBGET integrated database retrieval system