KEGG   Desulfovibrio alaskensis: Dde_3117Help
Entry
Dde_3117          CDS       T00294                                 

Definition
(GenBank) hypothetical protein
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3108090..3109004
Genome map
AA seq 304 aa AA seqDB search
MSRLEPAANLFDILHHFWEHPRTERYVAHTLIIIFLLSIATIEMNRHGLLPPRMAALTPT
NHFHAVNLAFTMLLVLEVMSLIFVLSTSVTKSLGKQLEILTLILLRNAFKSLSQMHEPIS
VLQDTEALLHVAASGTAALSIFVILGVYYRVQRFQGYLKDPTERMRYVLSKKILALVLFV
AFVSIGLYDALDFLIYGTHHDFFITFYTVLIFADILLVLITQRFMPNFHAVFRNSGFVIA
TLFMRVALSAPPFYAAGIGVGAALFALAVAYATSVFSHGTFSTVNFNRGADAEYKPPCKN
CQEP
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtcttgaacccgctgccaatctgtttgatatcctgcaccacttctgggagcac
ccgcgtacggaacggtatgtggcgcatacgctcatcattatttttctgctcagcatcgcc
accatagaaatgaacaggcacggcctgctgccgccccggatggctgcgctgacccccaca
aaccactttcatgcggtcaatctggcgttcaccatgctgctggtgctcgaggtcatgagc
cttattttcgtcctgtccacctctgtcaccaaatcccttggcaagcagcttgaaatactg
acacttatattgctgcgcaatgctttcaaatcgctttcgcagatgcacgaacccatatcc
gtcctgcaggacaccgaggcactgctgcatgttgccgcatcgggtacggcagcactcagc
atcttcgttattctgggtgtttattacagagtacagcgttttcagggctatctcaaagat
cccacggaacgtatgcgttatgtgctcagcaaaaaaattctcgcactggtgctgtttgtg
gcctttgtaagcatagggctgtatgacgcgctggattttctcatctacggcacgcaccac
gattttttcatcaccttctacaccgtgctgatatttgccgacattctgctggtgcttatc
acgcagcggttcatgcccaactttcacgcggtgttccgtaattccggctttgtcattgcc
acgctgttcatgcgcgtggctctttcagcaccgccgttctatgccgcgggcataggcgtg
ggtgcagcgctatttgcccttgcggtggcctatgccaccagcgtattttcgcacggcaca
ttttccacggtcaatttcaaccgcggggccgacgcagaatacaagccgccgtgcaaaaac
tgtcaggaaccatag

DBGET integrated database retrieval system