KEGG   Desulfovibrio alaskensis: Dde_3118Help
Entry
Dde_3118          CDS       T00294                                 

Definition
(GenBank) hypothetical protein
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABB39912
JGI: Dde_3118
UniProt: Q30WN4
Position
complement(3109114..3109341)
Genome map
AA seq 75 aa AA seqDB search
MSFTAVAKVGRSRYDTDPAVQMWLAGVKRHMEELAQDVGLAPELNVRLSVDDREVLLGVS
EQMDMYLREEPGSWR
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcaccgcagtggcaaaggtagggcgcagccggtacgataccgatccggcggtg
cagatgtggctggcaggggtgaaacggcacatggaggagctggctcaggatgtggggctg
gcacctgagctcaatgtgcgtctttccgtcgatgacagagaagtgctgctgggtgtcagc
gagcagatggatatgtatctgcgcgaagaaccgggcagctggcgatga

DBGET integrated database retrieval system