KEGG   Desulfovibrio alaskensis: Dde_3119Help
Entry
Dde_3119          CDS       T00294                                 

Definition
(GenBank) thiamine biosynthesis Thi4 protein
  KO
K07137  uncharacterized protein
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 DAO HI0933_like GIDA FAD_binding_2 Pyr_redox_3 NAD_binding_8 Thi4 FAD_oxidored Pyr_redox FAD_binding_3 Lycopene_cycl Amino_oxidase Trp_halogenase NAD_binding_9 ApbA GMC_oxred_N
Motif
Other DBs
NCBI-ProteinID: ABB39913
JGI: Dde_3119
UniProt: Q30WN3
Position
complement(3109516..3110907)
Genome map
AA seq 463 aa AA seqDB search
MSKAADNFDVIIVGGGPAGLFAAYYLAEHSGLSVCLIERGNAARKRNCPINKTQKCIKCK
PCHILSGMGGGGLFSDGKLNFIHKLGKTDLTQFLPRSKAEELIDETELIFNRFGMDGPVY
PSNLEAARLLRKQSKKHGIDLLLIKQKHLGSDCLPEHIARMCDYLTESGVTIRTGEEVKN
VVAENGQIQGLVTDKGQYTCRAVILAPGRVGADWVGEVCRSFGLQVSQRGIEVGVRVEVH
NDIMSDTTDIIYDPTFFVQTKTYDDQTRTFCTNPAGFIALENYQDFVCVNGHAYRNKKSE
NTNFAFLSKVVLTDPVSDNTGYGTAIGKLATIIGGGKPILQRFGDLKRSRRSTWNRISKG
YIEPTLTNVVPGDIAMALPERIVTNLVEGLEQLNHVLPGISNEETLLYAPEIKFFATQVE
TDNCLETGIRGLFVAGDGPGVAGNIVSAAATGLIPAKALIDRL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggctgcagacaattttgacgtgatcattgtcggcggggggcccgccggtctt
tttgccgcgtattatctggcggaacattccggtctgtccgtgtgtcttatcgagcgcggc
aacgcggcgcgcaagcgcaactgtcccatcaacaagacgcagaagtgcatcaagtgcaaa
ccgtgccacattctttccggcatggggggcggcggacttttttccgacggcaagctgaac
tttatccacaaactgggcaagaccgatctgacccagtttctgccgcgcagcaaggcagag
gagcttattgacgagaccgaactgattttcaaccgcttcggcatggacggccctgtgtat
ccttccaatctggaagctgcgcgtctgctgcgcaagcagtcgaaaaaacatggtatcgac
ctcttgcttatcaagcagaagcaccttggcagcgattgtctgcctgagcatatcgcccgt
atgtgcgactatctgaccgaaagcggcgtgaccatacgcaccggcgaagaagtgaaaaac
gtggtggccgaaaacggacagatacaggggttggtgacggataaagggcagtacacctgc
cgcgccgtcattctggcaccgggccgcgtcggggccgactgggtgggcgaagtctgccgt
tcgttcggactgcaggtaagccagcgcggcatcgaagtgggcgtgcgggtggaagtgcat
aatgacatcatgagcgataccaccgatatcatttacgaccccacgttctttgtgcagaca
aagacctacgatgaccagacgcgcacattctgcaccaatccggcaggcttcatcgcgctg
gaaaactatcaggactttgtctgtgttaacggacacgcctaccgcaacaaaaagtcggaa
aataccaactttgcttttctttccaaagtggtgcttaccgatcctgtttccgacaatacc
ggttacggcaccgccattggcaagctggccaccattatcggcggcggcaagcccatcctg
cagcggttcggcgatctcaagcggagccgccggtccacatggaaccgtatcagcaagggc
tacattgagccgacgctgaccaatgtggtgccgggcgatatcgccatggcactgcccgag
cgcatagtgacaaaccttgtggaaggtctggagcagctcaaccatgtgctgcccggcata
tccaacgaagaaacactgctgtatgctccggaaatcaagtttttcgccacgcaggtagag
acggacaactgtctggaaaccggcatccgcggtctttttgtggccggcgacgggccgggt
gtggcgggcaatatcgtatctgccgcagccacgggacttattcccgcaaaggcgcttatc
gaccgcctgtaa

DBGET integrated database retrieval system