KEGG   Desulfovibrio alaskensis: Dde_3121Help
Entry
Dde_3121          CDS       T00294                                 

Definition
(GenBank) Aldehyde dehydrogenase (NAD(+))
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00010  Glycolysis / Gluconeogenesis
dde00053  Ascorbate and aldarate metabolism
dde00071  Fatty acid degradation
dde00280  Valine, leucine and isoleucine degradation
dde00310  Lysine degradation
dde00330  Arginine and proline metabolism
dde00340  Histidine metabolism
dde00380  Tryptophan metabolism
dde00410  beta-Alanine metabolism
dde00561  Glycerolipid metabolism
dde00620  Pyruvate metabolism
dde00625  Chloroalkane and chloroalkene degradation
dde01100  Metabolic pathways
dde01110  Biosynthesis of secondary metabolites
dde01120  Microbial metabolism in diverse environments
dde01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dde_3121
   00053 Ascorbate and aldarate metabolism
    Dde_3121
   00620 Pyruvate metabolism
    Dde_3121
  Lipid metabolism
   00071 Fatty acid degradation
    Dde_3121
   00561 Glycerolipid metabolism
    Dde_3121
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dde_3121
   00310 Lysine degradation
    Dde_3121
   00330 Arginine and proline metabolism
    Dde_3121
   00340 Histidine metabolism
    Dde_3121
   00380 Tryptophan metabolism
    Dde_3121
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dde_3121
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Dde_3121
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dde_3121
Enzymes [BR:dde01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Dde_3121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABB39915
JGI: Dde_3121
UniProt: Q30WN1
Position
3111211..3112593
Genome map
AA seq 460 aa AA seqDB search
MTPERIYEVTEAQRAFFQSGATLDVDGRIASLRTLRGAVHDYTRRFIVAAAQDAGLSEHM
VLAAEIAPVINDIDHMIKRLPALAKGRLVRRSRLHMWGWSRSVPRPAGIAVAVTAADMPV
QRALMPVVSALAAGTPLLLALSPRTPAVNGIVERLVQQFFKPEQITVTTADNETTEAILG
QRFDACLCSAPRETAVRFARAAAEHLVPAVIETAEHRNPAIVLEDADIRLAARRIVWAKT
LAAGQTAAAPDYLVVHGAVRERLLAALRKELEAQHGAIPSASSAFGRMTDNAAYEEAAAF
LTDGTPVIGGDTDPAGRFINFTVLENVQPDAPVMRSVTRSPVLPLFEVQSAEQAVELVNS
RPAPLALYVFSTDVFTARKVLDATTSGTAAVNDVLVQTVYPALPFGDAAGGGMGSHRGEA
GFFAFSRLRSVTRGTNFIDLPFRFSPDAGWKQKILRYIIR
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgacacctgaacgcatatacgaagtgacggaagcccagagagcttttttccagtccgga
gccacccttgacgtggacggacgcattgcatcgctgcgcaccctgcgcggcgccgtgcat
gattacacccgtcgctttattgtagctgcggcacaggatgccggactttccgagcacatg
gtgcttgcggctgaaatagcccccgtcatcaacgacatcgaccacatgatcaaacgtctg
cccgcgctggcaaagggacggctggtgcgtcgttcgcggctgcatatgtggggctggtcg
cgcagcgtgccccgccccgcaggcattgccgtggccgtaaccgccgcggatatgcccgta
cagcgcgcccttatgccggtggtatctgcccttgccgcgggcaccccgctgctgctggca
ctttctccccgcactccggctgtcaacggcattgtggagcgccttgtgcagcagtttttc
aagccggaacagataaccgtgaccactgcggacaatgaaaccacagaggccattctcgga
cagcgtttcgatgcctgcctgtgctccgcaccgcgcgaaaccgccgtccggtttgcccgc
gccgctgcggaacaccttgtgcccgccgtcattgaaacagccgaacaccgcaatccggcc
atagtgcttgaagatgccgatatccggctggcagcgcggcgcatagtatgggccaaaact
cttgccgccggtcagaccgccgccgcgccggactatctggtggtgcacggcgcagtccgc
gaacgcctgctggcagccctgcgcaaagaactggaagcgcagcacggcgccataccctcc
gcaagttccgcattcggccgcatgacagacaacgcagcctatgaagaagctgcggcgttt
ctgactgacggcacgccggtcataggcggcgacaccgaccccgcaggcaggttcatcaac
tttaccgtactggaaaacgtacagccggacgcaccggtcatgcgttccgtcacccgcagt
ccggtgctgccgctttttgaggtgcagtctgcggaacaggccgttgaactggtgaacagc
cgtcccgcaccgctggctctgtatgtgttcagcaccgatgtgtttaccgcacgcaaagtg
ctggatgccacaacatcgggcacagcggcggtcaacgacgtgctggtgcagaccgtgtac
cccgccctgcccttcggcgatgcggcaggcggcggcatgggcagccaccgcggcgaggcg
ggattttttgccttttccagactgcgcagtgtcacacgcggcacaaacttcatcgacctg
ccgttccggttcagccccgatgccggctggaagcagaaaatcctgcggtacatcatcaga
taa

DBGET integrated database retrieval system