KEGG   Desulfovibrio alaskensis: Dde_3122Help
Entry
Dde_3122          CDS       T00294                                 

Definition
(GenBank) glycosyl transferase family 39
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3112765..3114360
Genome map
AA seq 531 aa AA seqDB search
MQKSPVWERRPWLCAAAIISFTTLVRFWFIASGQLDLVQDEAQYWDWTRRLQLSYYSKGP
LIAWLISIWTGVFGDTELGVRFAAVLNSCLAQILLYAGTARLMRRPVLGLWTLVVANTTP
LFIASGILMTTDSPLLVCWTGALMCLYWMSVSSRSPWPYVLLALSMAAGVLAKYMMLAMP
AVALLYALGLRRQRLLPEGMVPRLLAAVCAGTAVGMLPILIWNFQNDFVGFRHVAGLAGV
ASASPEPLIRFDRFPEYIASQVGIISPWWFVFMLVGAWRALRVWRTPRAGRDMYSGLRND
MNEVRQSLLLSAAFWPLWLFFIIWSFHTRIYPNWSAMSYVAGIMLCASALERSGQAVRET
GRHLSRLRMRRIWVAMGVLVFVLLYGQNWLPLPPAYNPAVRLKGWSDLSGKLEELQNSLP
RPDKVFYFSKSYDITAALAFYAPGQPFTYCADFGRRMSQYDLWPTPEDKKGWDAIYVQKD
NGIKPQLKSMFESYRVLRYRTTHKGAPGREFTIVVLRGFKGTWPREQQERY
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
ttgcagaaaagccccgtatgggagcgccgcccgtggctgtgcgctgccgccatcatatct
ttcacaacgctggtacgcttctggttcatcgcctccggccagcttgacctcgtgcaggac
gaggcccagtactgggactggacccgcagactccagctttcctactattccaaagggccg
ctcatcgcgtggctcatcagcatctggaccggtgttttcggcgatacggaactgggcgtg
cgctttgccgccgtgctcaattcgtgccttgcacagatactgctgtacgccggaaccgca
cggctcatgcgccgtccggtactgggtctgtggacactggttgtggccaataccaccccg
ctgttcatcgcctccggcattctgatgaccactgacagcccgctgctggtctgctggacg
ggtgcgctcatgtgcctgtactggatgtccgtatcatcacgctcgccatggccttatgtg
ctgctggccctttccatggccgccggagtgctggccaaatatatgatgctggccatgccc
gccgtggccctgctgtacgcgctgggactcagacgccagcggctgctgccagaaggcatg
gtgccgcggctgctggctgccgtctgtgccggtacggccgtgggtatgctgcccatcctc
atatggaatttccagaacgactttgtgggattccgccatgtggccggtctggccggtgtg
gcttcggccagccccgaaccgctcatccgctttgaccgctttccggaatatatcgcctcg
caggtcggcatcatcagtccgtggtggtttgtgttcatgctggtgggcgcatggcgcgcc
ctgcgtgtgtggcgtacgccgcgcgccggacgcgacatgtacagcggactgcgcaatgac
atgaacgaagtccgtcagtcactgctgctgtccgccgcgttctggccgctgtggcttttc
ttcataatctggagctttcacacccgcatctatcccaactggtcggccatgagctatgtg
gccggcatcatgctgtgtgcttccgcgcttgagcgcagtggacaggctgtgcgcgaaaca
ggcaggcatctttcgcggctgcgcatgcggcgcatctgggttgccatgggtgtacttgtt
tttgtgctgctgtacgggcagaactggctgcctctgccgcctgcgtacaacccggcggta
cggctgaaaggctggagcgacctgagcggcaaactggaggaactgcagaacagtctgccc
cgcccggacaaagtgttctatttttccaaatcatatgacatcacggcggcccttgccttt
tacgcacccggacagccgttcacttattgtgcagacttcggcaggcgcatgagtcagtac
gacctgtggcccactcctgaagacaaaaaagggtgggacgccatttatgtgcagaaagac
aacggcataaaaccacagctgaaaagcatgtttgagtcatacagggtgctgcgctaccgc
accacgcacaaaggcgcccccgggcgcgaattcaccattgtggtgctgcgcggcttcaaa
ggcacatggccgcgcgaacaacaggagcgttactga

DBGET integrated database retrieval system