KEGG   Desulfovibrio alaskensis: Dde_3129Help
Entry
Dde_3129          CDS       T00294                                 

Definition
(GenBank) Phosphate butyryltransferase
  KO
K00634  
phosphate butyryltransferase [EC:2.3.1.19]
Organism
dde  Desulfovibrio alaskensis
Pathway
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Dde_3129
Enzymes [BR:dde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.19  phosphate butyryltransferase
     Dde_3129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3122126..3123049)
Genome map
AA seq 307 aa AA seqDB search
MKMTCMEDLLAAAARTGTMPRVAVAASAQDVALLAALDAHARGIAEPVLVGDLEETRRIA
GRAGVDISALESHHVPDKAGAVQHALALFRAGDVSMLMKGNVNTDVLLKGVLNKETGVPP
AGILSHVAVFCLPGEHRLRLLTDAGVNIAPNLQRKAEIVRNALHVARSLGLERPRAAMLA
ATEKVMYPAMPATLDAQMVARMSAEGAFGDAVVSGPMALDLAVSPAAVARKGFEDPVAGN
ADVLVAPDIESGNVLYKTLTTLLDLPVAGIVAGSRIPLIVPSRGDSDRSKLYALALAAYM
TRKECTG
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgacttgcatggaagatctgctggccgcggcggcgcggacaggaaccatgccg
cgtgtggccgtggccgccagtgcgcaggatgttgcgttgctggccgcgctggatgcacat
gcccgcggcatagcggagcctgtgcttgtgggcgatctggaagagacacgccgcatagcc
ggacgggccggagtggatatttctgcgctggaatcgcaccatgtgccggataaggccgga
gccgtgcagcatgcactggccttgttccgcgcgggtgacgtttccatgctgatgaagggg
aacgtcaatacggacgtgttgcttaaaggcgtgctgaataaagaaacgggtgtgccgcct
gccggtattctttcgcatgtggcggtgttttgcctgcccggcgagcatcgtctgcgtctg
ctgacagatgcgggggttaacattgcgcccaacctgcagcgtaaggcggaaatagtgcgc
aacgcgctgcatgtggcccgctcgctggggcttgagcgaccgcgtgcggccatgctggcc
gccacggaaaaggttatgtatccggccatgcctgccacgctggatgcgcagatggtggcc
cgtatgagtgccgaaggggcattcggtgatgccgtggtttccggccccatggcgcttgac
cttgcggtatcgcccgcggcagtggcgcgcaaagggtttgaagacccggtggccggtaat
gccgacgtgctggtggcgccggatatcgaaagcggtaatgtactgtacaagaccctcacc
acactgctggacctgcccgtggcgggcattgtggccggcagcaggattcctcttatcgtc
ccttcccgcggcgacagcgaccgcagcaaactgtatgcactggctctggcagcctacatg
acccgtaaggaatgcaccggatga

DBGET integrated database retrieval system