KEGG   Desulfovibrio alaskensis: Dde_3133Help
Entry
Dde_3133          CDS       T00294                                 

Definition
(GenBank) Rhodanese-like protein
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese
Motif
Other DBs
NCBI-ProteinID: ABB39927
JGI: Dde_3133
UniProt: Q30WL9
Position
3124152..3124610
Genome map
AA seq 152 aa AA seqDB search
MIPDFTHRKALTAGVLVFLMLASGMAFMQWYRYGHTADTGMQLVPVSATQAAGLLNEKSV
IPLDVRTPAEFARGHIKGAVNADFHAPDFAGQLARLDSRAAYLLYCRSGARSARTLRTLE
KLGFKGPVYHLQHGLLEWEQHKLPLTKNGTAH
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgataccggactttacgcaccgcaaggctctgactgcgggagtgcttgtttttctcatg
ctggcttccggcatggcctttatgcagtggtaccgctacgggcacaccgcggatacaggc
atgcagctggtaccggtatccgccacacaggctgccggactgctgaatgagaaaagcgtc
atccctcttgatgtccgcactccggcagaatttgcccgcggacatatcaagggcgcggtc
aatgccgactttcatgcaccggactttgccggacaacttgcccggctggattcccgcgca
gcgtacctgctgtactgccggtccggagcacgcagcgcacgcacgctgcgcacactggaa
aaactgggtttcaaaggtcccgtgtaccatctgcagcacggtctgctggaatgggaacag
cacaagctgcccctgacaaaaaatgggaccgcgcactaa

DBGET integrated database retrieval system