KEGG   Desulfovibrio alaskensis: Dde_3139Help
Entry
Dde_3139          CDS       T00294                                 

Definition
(GenBank) cupin 2 conserved barrel domain-containing protein
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3130537..3130944
Genome map
AA seq 135 aa AA seqDB search
MNTTFQGDGIFPKGPENKSYAQYFTGTSYLEILSAEGVVIGNVTFEPGCRNFWHIHRKGG
QVLLVTGGRGWYQEEGKPAQELRAGDVVNIPPDTKHWHGAARDSWFAHLAVEVPAEGRSN
EWLEPVSDEEYNALS
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccacatttcagggagatggaatttttcccaaggggccggaaaacaaatcttat
gcacagtattttaccgggactagctatctggaaatactgtctgctgaaggcgttgtcatc
ggtaacgtcacctttgaaccgggctgccgcaacttctggcatatccaccgcaagggtggt
caggttctgctcgtgaccggcggccgcggctggtatcaggaagaagggaaacccgcgcag
gagctgcgtgccggagacgttgtgaatattccgccggataccaagcactggcacggtgcc
gccagagatagctggtttgcccatctcgccgtggaagtgcctgcggaggggagatccaac
gaatggctggaacctgtttccgacgaggaatacaacgcgctcagctaa

DBGET integrated database retrieval system