KEGG   Desulfovibrio alaskensis: Dde_3140Help
Entry
Dde_3140          CDS       T00294                                 

Definition
(GenBank) Carboxymuconolactone decarboxylase
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3130978..3131703
Genome map
AA seq 241 aa AA seqDB search
MNIKQLTAIAVAAIILGTVAASEVQAMNNALDARQQAIVAIAAFTASGDMGRLTPALHEG
LNSGLTVNEVKEILVQMYAYTGFPRSLNGMAAFMKVVDERKAKGILDEIGRDASPIPADL
DKDAYGARVRADLSGLKDVPPPAAWQEFSPVIDDFLKQHLFADIFARDVLTRQERELATV
AALANMTGTAGQLSYHLGAAMNTGLTEAQMQSFVTVLAAKVGEDEAAIAGEVLEGVLAKR
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcaaacaattaacggctattgcggttgctgccataattttgggaaccgttgcc
gcatcggaggtacaggccatgaacaatgcactggatgcgcggcagcaggccattgtggcc
atcgccgcctttacggctagcggtgacatggggcgccttactcctgcgctgcatgaaggg
ctgaattccggcctgacggtcaatgaggtgaaggaaatcctcgtgcagatgtacgcctac
accggattcccgcggagcctgaacggcatggctgccttcatgaaggttgtggacgaacgc
aaggccaaagggattctggacgagataggcagggacgccagccccattccagccgacctg
gacaaggatgcctatggtgcccgtgtccgggcggatttgtccggtctgaaggacgttccg
cctcctgctgcatggcaggagttttcacctgttatcgatgactttctcaagcaacatctt
tttgccgacatcttcgcccgcgacgtactgacccgtcaggaacgcgagttggcgacagtc
gctgcgcttgcaaatatgaccggcacggcggggcagctctcttaccatttgggggcagcc
atgaacacgggactgaccgaggcgcagatgcagagctttgtgacggtactcgcggccaag
gtgggtgaagacgaggccgcaattgccggagaggtgctcgagggcgttctggccaaacgc
aaatag

DBGET integrated database retrieval system