KEGG   Desulfovibrio alaskensis: Dde_3141Help
Entry
Dde_3141          CDS       T00294                                 

Definition
(GenBank) NADPH-dependent FMN reductase
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3131821..3132357
Genome map
AA seq 178 aa AA seqDB search
MSKTILCISSSPRAKGNSDLLCDAFMHGATEAGHTVEKVRLAEKNINYCTGCCSCIGGSG
VCAQQDDMADILGKLIAADVIVFATPVYFRSFNGPMKTFIDRVCPVYTHVSDKDVYFIIS
AAGGALPVESTEQSFRTFTGCLRNIREKGTISITGVWDEDSVKGTRALQQAHAAGSKA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaacaattctttgtatctcgtcgagccccagagcaaagggcaactctgacctt
ctgtgcgatgccttcatgcatggagcgactgaagccggacatacggtggaaaaggtccgc
cttgcggagaagaatatcaactactgcacagggtgctgcagctgtatcggcggctctggc
gtctgtgcgcagcaggatgatatggcagacattctgggcaagctgatcgctgccgatgtg
attgtttttgccacgccggtgtatttccggtccttcaacggccccatgaagacgttcatc
gaccgggtgtgtcccgtttacacgcacgtcagtgacaaggacgtgtattttatcatctcc
gcagctggcggtgccctgccggtggaaagcacggagcagagttttaggacgtttaccggg
tgtctgcgcaatatcagggaaaagggaacgatttccattactggcgtgtgggatgaagat
tcggttaagggaacccgcgcgctgcaacaggcacatgcggctggatcgaaggcctga

DBGET integrated database retrieval system