KEGG   Desulfovibrio alaskensis: Dde_3148Help
Entry
Dde_3148          CDS       T00294                                 

Definition
(GenBank) ABC-type transporter, periplasmic subunit family 3
  KO
K02030  
polar amino acid transport system substrate-binding protein
Organism
dde  Desulfovibrio alaskensis
Module
Putative polar amino acid transport system
Brite
Transporters [BR:dde02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    Dde_3148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3134797..3135558
Genome map
AA seq 253 aa AA seqDB search
MPHTRPMLLFFTGAILLVLFSAVPRTQAGNGTLVLGAAEMCRQEHVQLVGQLYSAIFAHV
QRDVSIRPLPLKRLEKLVESGKLDGDFLRADDGTNLNGMLVKVDEPVFDIRYSLYVTDPE
LQDISTLQRLTRPGTRALQVGYIRGSVTGRIAAQTLAAGHTIYRLNTYAQGIDMLRAGRI
DMLIGAATVLDCMLATRNDAQPAVIKTGKAVEMPGYIYLAARHADLAPRLKEAIRRMKQD
GSFRAILREADRL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcctcatacccgccccatgctcctgttttttaccggcgccattctgctggttcttttt
tccgcagtcccccggacgcaggcaggcaacggcacgctggttctgggagcagcggagatg
tgccggcaggaacatgttcagctggtaggacagttgtactccgccatcttcgcccatgtg
cagcgcgatgtctccatcaggccgctgcctctcaagcgccttgaaaaacttgtcgaatcc
ggcaagctggacggagattttctgagggcggacgacggcaccaacctgaacggcatgctg
gtgaaggtggacgaacctgtttttgacatacgctacagcctgtatgtcacagaccctgag
ctgcaggatatctccacgctgcagagactgacgcgccccggcacaagagcgctgcaggta
ggctatatacgcggttcggtcacaggacgcatagccgcgcagacccttgccgcgggccac
accatttacagactgaacacctacgcgcagggcatagacatgctgcgcgcgggccgcata
gacatgcttataggtgcagccacggtgctggactgtatgctggcgacacgcaacgatgca
cagcccgccgtcatcaaaaccggcaaagctgtcgagatgccgggctacatctatctggcg
gccagacacgcagatctggctccccgcctgaaagaggcaatccgccggatgaagcaggac
ggctcgttccgcgctattctgcgcgaagcagaccggttgtag

DBGET integrated database retrieval system