KEGG   Desulfovibrio alaskensis: Dde_3152Help
Entry
Dde_3152          CDS       T00294                                 

Definition
(GenBank) flagellar hook-associated protein FlgK
  KO
K02396  
flagellar hook-associated protein 1 FlgK
Organism
dde  Desulfovibrio alaskensis
Pathway
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:dde00001]
 Cellular Processes
  Cell motility
   02040 Flagellar assembly
    Dde_3152
Bacterial motility proteins [BR:dde02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    Dde_3152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3137932..3140022)
Genome map
AA seq 696 aa AA seqDB search
MTLNSLLSVGKDALFASQSAIQTTGNNIANVNTPGYSRQAVRFEAKTPIDWKPGQMGTGV
KAAEVFRYFNTFIEQEYHDHFATEQRWKAQHQMLQSVESLFNESNSKGINAALSQFFTDW
QQLAQRPDDKATREALLAHTQSLTSLINSTADSMNQLEHQMDEYIRQDVDKANKLIKDIA
ELNRSIQVHDIPGSNNANTLLDQRNQMVRELAAIMDVDVIDRGSGDFVVNTKAGHTLVDG
EESFELKFEGPKTSAVVKGVPPFDGEIVFEGSSAREYTLEIVSGGAVGGGATFKVSYDGG
RTWLTDETTGLPKEFQANAQTGKVHVDGLDIYFNAGANDLAAGDEFTIVPKSGLYWVRPT
TEPLNITPMAFAEGGDNPRRLVGGTLAGYFSFRDANLGKYQEKLDAFSRELAWQVNYLHS
QGAGLGHLDYTRGGDSVNDPALALGDASSGLSYFDKLKSGNLTMYFFDSATGELASGASF
GPLDFGGGANFDPSVHTLDDVVNAINTSWGGYVTASIADNQLVLDAADGYQFGFADDSTG
LLAALGINTYFQGDSAVTLGMRPEVLADVSRINAGRINGGGEANVGDNDTATAISGLATK
KLDIPTSYEQGRNQSLSEYFNTISANVGSDTAQAKFGSDFYGTLADDLSARQDSVAGVNL
DEEMSSLVKFQHSYKAAAKLVTTADEMLQVLLGLKQ
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttaactcgctgctcagcgtgggcaaggatgcgctgtttgcgtcgcagagcgcc
atccagaccacaggtaacaatatcgccaacgtgaacacccccgggtattcgcgtcaggcc
gtacgttttgaagccaaaacccccatcgactggaaacccggccagatgggaaccggcgtc
aaggcggcggaggttttccggtacttcaatacctttattgaacaggaataccacgatcac
tttgccaccgagcagcggtggaaagcgcagcatcagatgctgcagagcgtcgagagtctt
ttcaacgaatccaattcgaaaggcataaacgccgcgctttcgcagtttttcaccgactgg
cagcagctggcgcagcgtcccgacgacaaggccacgcgcgaagctttgctggcacacacc
cagagcctgacaagtctcatcaacagtacagcggattccatgaatcagctggaacaccag
atggatgagtacatccggcaggatgtggacaaagcaaacaagcttatcaaggatatcgcc
gagctgaaccgttccattcaggtgcacgatattcccggatcaaacaacgccaacacgctg
cttgaccagcgcaaccagatggtacgcgaactggcggccatcatggatgtggatgtcatc
gacagaggcagcggtgactttgtggtcaacaccaaggccgggcatacgctggtggacgga
gaggaatcgtttgagctgaaatttgaaggccccaaaaccagcgccgtggtcaagggcgtg
ccgccttttgacggcgagattgtctttgaaggttcttcggcccgtgaatacacgctggag
attgtttccggcggtgccgtgggaggcggcgccacgttcaaggtttcgtacgacggtggc
cgcacatggctgacggacgagaccacggggctgcccaaagagtttcaggccaatgcgcaa
accggcaaagtgcatgtggacggtcttgatatatacttcaatgccggtgccaatgacctt
gccgcaggggacgaatttaccatcgtgcccaaaagcggcctgtactgggtgcggcccacc
actgaaccgctgaacataacccccatggcgtttgccgagggcggcgacaatccgcggcgc
cttgtgggcggtactctggccggctatttcagcttccgtgatgccaatctgggaaaatat
caggaaaagctggatgctttttcccgcgagctggcgtggcaggtcaactatctgcacagt
cagggtgccggtctgggccatcttgactacacacgcggcggcgacagtgtgaacgacccc
gcgctggcgctgggcgatgcgtcttccggtctgtcctatttcgacaagctgaagtccggc
aacctcacgatgtacttttttgactctgcaacgggcgaactggcctccggggcctctttc
ggcccgcttgatttcggcggcggagccaacttcgatccttctgtgcatacgcttgacgat
gtggtgaatgccataaacacatcgtggggcgggtatgtcaccgcgtccatagcagacaac
cagctggtgctggatgccgccgacggctaccagttcggctttgccgacgacagcacggga
ttgctggctgcactgggcatcaatacatattttcagggtgattcggcggtgacgctgggc
atgcgtcccgaagtgctggccgatgtgagccgcatcaacgccggacgcatcaacggcggc
ggagaagccaatgtgggcgacaacgacaccgccacggccatcagcggactggcaaccaaa
aagctcgatattcccacaagctacgaacagggacgcaatcagtcactttcggaatatttc
aacaccatttccgccaacgttggttcggatacggcgcaggccaagttcgggtcggatttt
tacggcacgctggccgacgacttgagtgcgcgacaggattccgttgccggggtgaatctg
gacgaggagatgagcagccttgtcaaatttcagcattcatacaaggcggccgccaagctg
gtgaccacggccgacgaaatgctgcaggtgcttctgggactcaagcagtag

DBGET integrated database retrieval system