KEGG   Desulfovibrio alaskensis: Dde_3155Help
Entry
Dde_3155          CDS       T00294                                 

Definition
(GenBank) flagellar P-ring protein
  KO
K02394  
flagellar P-ring protein precursor FlgI
Organism
dde  Desulfovibrio alaskensis
Pathway
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:dde00001]
 Cellular Processes
  Cell motility
   02040 Flagellar assembly
    Dde_3155
Bacterial motility proteins [BR:dde02035]
 Flagellar system
  Flagellar assembly proteins
   M,S,P and L rings
    Dde_3155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3141669..3142781)
Genome map
AA seq 370 aa AA seqDB search
MTFFTRCFRRGALLFLLAVLLLPSPAQAVRIKDIASFGGVRDNDLMGYGLVVGLGGTGDK
KSSTFTISSMVNMLDKMGIAVDRTKLTPKNVAAVMVTTRMPVSARPGSRLDITVSSLGDA
TSLLGGVLLMTPMKGVDGKVYALAQGPLALGGFSAEGDAARAQKNITTVGRIPGGAVVER
AVPFEFNTQNKLTLHMNVQDFSTTMQVVDRLNDNMGGQFASARDIATVDIMVPPAYRGNL
VPLMASLENLPVTPDSPARVVVDEKTGTVVVGNSVRISKVAVSHGNLQIVVQENPQVSQP
GAFSPGQTVVTPQTDIAAQEENRRLVMMEGATLQELVDGLNSIGATPRDLISILRTLKAA
GALHAELEVI
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaccttttttacccgttgcttccgccgtggcgcgctgctttttctgctggctgtcctg
ctgctgccttcgcccgcccaggctgtacgcatcaaggacatagcctcgttcggcggtgtg
cgcgacaacgacctcatgggctacgggcttgtggtggggcttggcggtacgggtgacaaa
aaatcatccacgttcaccataagctccatggtgaacatgctcgacaagatgggcatagcc
gtggaccgcaccaagctgacacctaaaaacgtggccgctgtgatggtgaccacgcgcatg
cccgtgtcggcccgtccgggttcgcgtctggatattacggtatcatcgctgggagacgcc
accagtctgctgggcggcgtgttgctgatgacacccatgaaaggggtggacggcaaggtg
tatgcgctggcacagggaccgcttgccctgggcggtttttcggcggaaggcgatgcggcg
cgggcgcagaagaacatcaccaccgtgggccgcattcccggcggtgccgtggtggagcgt
gccgtgccgtttgaattcaacacccagaacaagctgacgctgcatatgaacgtgcaggat
ttttccacaaccatgcaggtggtggacaggcttaatgacaacatgggcggccagtttgcc
agtgcgcgcgatatagccaccgtggacatcatggtgccgcccgcctacaggggcaatctg
gtgccgctgatggcttcgctggaaaacctgcccgtaacgccggacagccccgcccgtgtg
gtggtggatgaaaagaccggaaccgttgtggtgggtaacagtgtgcggatttccaaggtt
gccgtgtcgcatggcaatctgcagatagtggtgcaggaaaatccgcaggtttcgcagccc
ggagccttcagcccggggcagaccgtggtcactccgcagacggatatagccgcacaggaa
gagaaccggcggctggtgatgatggaaggagccacgctgcaggaacttgtggacggcctg
aattccataggcgccacaccgcgcgatcttatttccatactgcgcacgctcaaagcggcg
ggcgcgctgcacgcggagctggaggtcatctag

DBGET integrated database retrieval system