KEGG   Desulfovibrio alaskensis: Dde_3159Help
Entry
Dde_3159          CDS       T00294                                 

Definition
(GenBank) flagellar basal-body rod protein FlgF
  KO
K02392  
flagellar basal-body rod protein FlgG
Organism
dde  Desulfovibrio alaskensis
Pathway
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:dde00001]
 Cellular Processes
  Cell motility
   02040 Flagellar assembly
    Dde_3159
Bacterial motility proteins [BR:dde02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    Dde_3159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3145400..3146182)
Genome map
AA seq 260 aa AA seqDB search
MQDSMYSALFGALTNEHRLNNIANNLANVNTTGYKRDVLAFKDTFLSFAHDEVMEPIPNV
RSKKMFPEPIHIAKPRIALAKTDFSQGSLKLTGGTLDMAVHGDGFFKVRTPDGEFYTRNG
NFRQTSDGQLVTQQGWPVLGAGGDIQIPPRANLTVAENGTIYADGEEIGQVQVVTLDNLD
ALEKQGSNLFRLREGAEAQEVPVENPVVLQGFLETANVEVVTEMVNMIEANRQFEAYQKI
MQTTDAVDKMATTQVGRGRA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacagtatgtatagcgcgttattcggggcgcttaccaacgaacaccggctgaac
aacatcgccaacaatctggcgaacgtgaataccaccgggtacaaacgcgacgtgctcgcg
ttcaaggacacttttctttcctttgcccatgacgaggtgatggaacccatacccaatgtg
cgttccaagaagatgtttccggagccgatacacattgccaaaccgcgcatagcgctggcc
aagaccgatttcagtcagggcagcctgaagctgacaggcggtacgctggacatggccgtg
cacggcgacggctttttcaaggtgcgtaccccggacggcgagttctacacccgtaacggc
aacttccgtcagacttccgacggtcagctggtaacgcagcagggctggcccgtgctggga
gcgggcggagacatacagattccgccgcgtgccaatctgacagtggcggaaaacggcacc
atctatgccgacggtgaagagataggtcaggtgcaggtggtcacgctggacaatctggat
gcgctggaaaaacagggaagcaaccttttccgactgcgtgagggagcggaggcgcaggag
gttcctgtggaaaaccccgtggtgcttcaggggtttctggaaacggccaacgtcgaggtt
gttactgaaatggttaacatgatcgaagccaaccgtcagtttgaagcttatcagaaaatt
atgcagaccactgatgccgtggacaaaatggccaccactcaggtgggcagaggccgtgcg
taa

DBGET integrated database retrieval system