KEGG   Desulfovibrio alaskensis: Dde_3171Help
Entry
Dde_3171          CDS       T00294                                 

Definition
(GenBank) GCN5-related N-acetyltransferase
  KO
K03824  
putative acetyltransferase [EC:2.3.1.-]
Organism
dde  Desulfovibrio alaskensis
Brite
Enzymes [BR:dde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     Dde_3171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3158427..3158963)
Genome map
AA seq 178 aa AA seqDB search
MDITVHRTGSNEAIINLFTRTFADSEGEAEGQVIGGLVHDLLTTTAEEDIYCVTATEDGE
VVGCIIFTRLTLTDGPVAFLMAPVAVLTGCQGKGTGQMLIKSGLEKLKEHGVELVFTYGD
PDFYGKTGFRPVSEDVVRAPLKLTYPEGWLGQSLAGTGIRPVAGRSYCVEAFNKAVYW
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggatattaccgtgcatcgcaccggaagcaacgaagccataatcaatcttttcacccgt
acgtttgcagattcggaaggtgaagcggaaggacaggtgataggcgggctggtgcatgac
ctgctgacgactacggcggaagaagatatttactgcgtcaccgcaactgaagacggtgaa
gttgtcgggtgtatcatttttacccgtctgacattgacagacggccccgtggcattcctg
atggctcctgtagctgttcttaccggctgtcagggaaaaggcacagggcagatgctgata
aaaagcggccttgaaaaattgaaggagcacggggtggagctggttttcacatacggcgat
cctgatttttacggcaaaaccggtttcagaccggtgagcgaagatgttgtccgtgctccg
ctgaaactgacctaccctgaaggctggcttgggcagtctcttgccggtaccggcatccgg
cctgttgccggcagatcatactgtgttgaagcgtttaacaaagcagtttactggtga

DBGET integrated database retrieval system