KEGG   Desulfovibrio alaskensis: Dde_3176Help
Entry
Dde_3176          CDS       T00294                                 

Definition
(GenBank) AzlC family protein
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3163578..3164324
Genome map
AA seq 248 aa AA seqDB search
MQPSSPPSPSSPLPAPFSQLQKGFAANLVVAASVAAYGSVFGLLAAQKGIGWGQLLFMNL
TIFAGSAQFVMVDMWQPPLPVAEIALAVLVINTRYLLIGASLRQLFAGTTLTHKALVMHL
VTDENWAVTLAAASKRPVDTYFMLGGGLCILMAWCAGSLFGNQVGALLGNPERLGLDFAF
TAVFTALLCSFWRGGRDLLPWLTAAAVALVVEQAVPGSKWYIPAGGLSGALCAALMPAHA
AGKDRKQT
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
ttgcagccttcatccccgccatccccttcatccccgctgcccgctccgttttcccagctg
caaaaaggctttgccgccaacctcgtcgtggcggccagcgtagccgcttacggcagcgtt
ttcggcctgctggcagcccagaaaggtatcggctgggggcagctgctgttcatgaacctg
accatctttgccgggtctgcacagtttgtcatggtggatatgtggcaaccgcccctgccg
gtggcggaaatagcgctggcggttctggtcatcaacacacgctatctgctcatcggggca
tcactgcgtcagctttttgccggaaccacactgacccacaaggctcttgtcatgcatctg
gtcaccgacgaaaactgggccgtcacgctggctgcggcctcaaagcgtcccgtggacaca
tacttcatgctcggcggcggcctgtgcattctgatggcatggtgtgccggttcgctgttc
ggcaatcaggtgggggcgttgctgggcaaccccgagcgcctggggcttgatttcgcgttt
acagccgtgttcaccgcactgctgtgcagcttctggcggggcggcagagacctgctgccg
tggctgactgccgcggccgtggctctggttgtggaacaggctgttcccggcagcaaatgg
tacatacccgccggaggcctgagcggcgccctgtgcgccgcgctgatgcccgcacacgcg
gcgggaaaggacagaaagcagacatga

DBGET integrated database retrieval system