KEGG   Desulfovibrio alaskensis: Dde_3177Help
Entry
Dde_3177          CDS       T00294                                 

Definition
(GenBank) branched-chain amino acid transport
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AzlD
Motif
Other DBs
NCBI-ProteinID: ABB39971
JGI: Dde_3177
UniProt: Q30WH5
Position
3164321..3164620
Genome map
AA seq 99 aa AA seqDB search
MTENTAAFLAVILAAAATYALRLGGLLLAGKLPDTGRARRFMDALPGTILLSIVVPASVS
LGPWGWFASACTIACMRLTGNVLAAMLSGVVIMALSRAL
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaaacaccgcggcctttctggccgtcatactggctgcggcagccacctacgcc
ctgcgcctcggtgggctgctgctggcaggcaaacttccggataccggcagggcgcgccgg
ttcatggatgcactgccgggcaccatactgctgtccattgtggtgccggcctcggtcagc
ctcggcccctgggggtggtttgcctccgcctgcaccatcgcctgcatgcgcctgaccggc
aatgtgctggcagccatgctcagcggcgtggttatcatggcgctcagccgcgcgctgtaa

DBGET integrated database retrieval system