KEGG   Desulfovibrio alaskensis: Dde_3180Help
Entry
Dde_3180          CDS       T00294                                 

Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  
glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
dde  Desulfovibrio alaskensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dde_3180
Enzymes [BR:dde01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Dde_3180
Amino acid related enzymes [BR:dde01007]
 Aminotransferase (transaminase)
  Class III
   Dde_3180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3166349..3167617
Genome map
AA seq 422 aa AA seqDB search
MERSRNLFERAQKLIPGGVNSPVRACLSVDSAPVFVERGQGSKLYSVDGREYIDFVESWG
PLLLGHAHPAVNKAIHEAVDKGSSFGAPCEDEIRLAEAVVDAVPSIEMVRMVSSGTEATM
SALRLARGYTGRNKLIKFEGCYHGHGDAFLASAGSGVATLSIPGTPGVPDTVVADTLLAP
YNNLERVKALFENHGADIAAVIVEPTAGNMGLVRPAAGFLQGLRELCDRYGALLIFDEVI
TGFRLSYGGAQQYFGITPDLTTLGKIIGGGMPVGAYGGRREIMERIAPCGDVYQAGTLAG
NPVAMAAGIATLAELKKADYPALEKRVDALASEIEAILKAKGVPVTVNRLASMFTIFFTE
EPVTDYDSAKKADGTLYTRFYQQMRDQGIYLAPSGFECAMVSLAHTEDDFAAMLAAVRNV
TF
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttccagaaatcttttcgaacgcgcccagaaacttattcccggcggggtgaac
agccccgtgcgcgcctgtctgagcgtagacagcgcccccgtgtttgtagaacgcgggcag
ggcagcaagctgtacagcgttgacggcagagaatacatcgactttgtggaatcgtggggg
ccgctgctgctgggccatgcccaccccgccgtcaacaaggccatccacgaagccgtggac
aaggggtcgagtttcggcgccccctgcgaagacgaaatccgccttgcagaagccgtggtg
gacgccgtgcccagcattgagatggtgcgcatggtcagctccggcacagaagccaccatg
tctgccctgcgccttgcgcgcggctacaccggccgcaacaaactgattaaatttgagggc
tgctaccacggccatggcgatgcttttctggccagcgcaggttccggagtggcaacgctt
tccattccgggaacccccggcgtgcccgacacagtggtggcggacaccctgctggcaccc
tacaacaaccttgaacgcgtaaaagccctgtttgaaaaccacggcgcagacatcgccgca
gtcatcgtggagcccacggcgggcaatatgggactggtacggcccgccgccggttttctg
cagggattgcgcgaactgtgcgaccgctacggcgcgctgcttatcttcgacgaggtcatc
accggcttccggctgtcctacggcggggcacagcagtatttcggcatcacccccgacctg
accacactgggcaaaatcatcggcggcggcatgcccgtgggcgcctatggcggcagacgc
gagataatggagcgcatcgctccctgcggcgatgtgtatcaggccggcactctggcaggc
aaccctgtggccatggccgcaggtatcgccacgctggcggaactgaaaaaagccgactat
cccgcactggaaaaacgtgtggacgcgcttgcttctgaaatagaagccattctcaaggcc
aagggcgtacccgtgacagtcaaccgtctggcctccatgttcaccatcttcttcaccgaa
gaaccggtgactgactatgacagcgccaaaaaagccgacggcacgctctacacccgcttt
taccagcagatgcgtgatcagggcatctaccttgccccgtccggttttgaatgcgccatg
gtgtcgctggcccacacagaagacgactttgcggccatgctcgcagcagtgcgcaacgtc
accttctag

DBGET integrated database retrieval system