KEGG   Desulfovibrio alaskensis: Dde_3186Help
Entry
Dde_3186          CDS       T00294                                 

Definition
(GenBank) Protein of unknown function DUF2065
  KO
K09937  uncharacterized protein
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2065
Motif
Other DBs
NCBI-ProteinID: ABB39980
JGI: Dde_3186
UniProt: Q30WG6
Position
complement(3174163..3174393)
Genome map
AA seq 76 aa AA seqDB search
MKKNALMEFTKQLLSAAVGLWLFAEGITFFLGAERLKPVLRALAETRTAHLRITGLVMML
LGVGAVALARYYFISG
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaacgcccttatggaattcacaaaacagttactttctgctgcggtcggcctg
tggctttttgccgaaggcattactttttttcttggcgccgagcgcctgaagccggtgctg
cgcgcccttgcggaaaccagaaccgcccatctgcgcattaccggtctggtcatgatgctg
ctgggcgtcggggctgtggcgctggcccgttattatttcatttccggttag

DBGET integrated database retrieval system