KEGG   Desulfovibrio desulfuricans G20: Dde_3283Help
Entry
Dde_3283          CDS       T00294                                 

Definition
acetaldehyde dehydrogenase
Organism
dde  Desulfovibrio desulfuricans G20
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3274261..3275769)
Genome map
AA seq 502 aa AA seqDB search
MMIVDNDLISIQEARILAENAGRAQRVLATFSQEQLDEIVEAVAEAVGAQAQALADMAYE
ETDYGNPHDKAVKNRFVCTQVREQLRGMRCVGVIGRDEHARTMDIGVPVGVIAALCPATS
PVSTTICKTLIAVKSGNAVVFSPHPRAARSIAAALDIMIDAARAHGLPEGCLSYMSTVTK
SGTAELMNHPATSLVMLSGVPGMIGLARCSGKPVIYGGTGNGPAFVERSADIRRAVADIM
LSKTFDNGIAPSAEQSIVVDSCIEREVRHALQECGAYFMTDEESLRLAELLFCADGRHKA
GMVGVSAPVLARRAGISVPDNVRLLVAERKYVSEADPYSRELLSPVLAYYVEDDWMHACE
KCIELLLHERNAHTLVIHSSNEEVILQFALKKPVGRLLVNTPATFGGMGVTTNLFPSMTL
GSGSAGRGITADNVSPMNLIYIRKVGYGVRQYTGAQDAAGYGSRVCAAQGVMAPHDSDSR
KMQALHRILMEAIGVMDGAAHR
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgatgattgtcgataacgatctgatttccatacaggaagccagaattctggcagaaaac
gcagggcgcgcacagcgggttctggccacgttttctcaggaacagctggacgagatcgtc
gaagccgtagccgaagccgtgggggcgcaggcgcaagcgcttgcggacatggcgtacgaa
gaaaccgactacggcaacccgcatgacaaggcagtgaaaaaccgctttgtatgcacgcag
gtgcgcgagcagctgcgcggcatgcggtgtgtcggcgtcatcggacgggatgagcacgca
cgcaccatggacattggtgtacccgtaggcgtcattgccgcgttgtgtccggcgaccagc
cccgtgtccacaaccatctgcaagacgctcatagccgtcaaatcaggcaacgccgtagtt
ttttcccctcatccgcgcgctgccagaagcatagccgccgcgcttgatatcatgattgat
gccgcgcgggctcacggtctgccggaaggatgtctttcatacatgtccacggtaaccaaa
agcggtaccgccgaactgatgaaccatcctgccacatcgctggtcatgctttcgggcgtg
cccggcatgatagggcttgcgcgctgcagcggcaaacccgtgatttacggcggcaccggc
aacgggcctgcatttgtcgaacgctcggccgacatccgccgcgccgtggccgacatcatg
ctcagcaagacgttcgacaacggtatcgcgccgtccgcggaacagtccatcgtggtcgat
tcctgcatcgagcgggaagtcagacatgccctgcaggagtgcggcgcatacttcatgacg
gacgaggagtccctgcggctggcggagcttcttttctgtgccgacggacgccacaaagcc
ggcatggttggtgtgtctgccccggttctggcgcgcagggcaggcatcagcgtgcccgac
aacgtgcggctgctggtggcagaacgtaaatatgtttccgaagcagacccgtattcaagg
gaactgctttcccccgtccttgcctattacgtggaggacgactggatgcacgcctgtgaa
aagtgcatcgagctgctgctccacgaacgcaacgctcatactctcgtgatccattccagt
aacgaagaggtgattttgcagtttgccctgaaaaaacctgtgggccgtctgcttgtaaac
actcccgccacattcggcggcatgggtgtgaccaccaatctcttcccgtccatgacgctg
ggcagcgggtccgcagggcgcgggatcaccgccgacaacgtgtcgccgatgaatctcatc
tacatacgcaaggtcggttacggcgtgcggcagtacaccggcgcacaggacgccgcggga
tacggttcccgcgtttgcgccgcgcagggcgtcatggcccctcatgacagcgattccaga
aaaatgcaggcgttgcaccggatcctgatggaagcgatcggggtcatggacggggcagca
cacagatga

DBGET integrated database retrieval system