KEGG   Desulfovibrio desulfuricans G20: Dde_3421Help
Entry
Dde_3421          CDS       T00294                                 

Definition
glycoside hydrolase
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
dde  Desulfovibrio desulfuricans G20
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3384218..3384664)
Genome map
AA seq 148 aa AA seqDB search
MAIDLAKRFEGFHRVPKTDPGRAHPYICPAGFWTIGYGHLCDPKHPPITEAEAEVYLARD
LQSALAATLRYCPVLATEPESRLAAIVDFTFNLGAGRLQTSTLRRRINRRDWPAAATELR
RWVYGGGRVLPGLVTRREAEATCLLRAA
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggccatcgacttggccaagcgcttcgagggcttccaccgcgtgccgaagaccgatccg
ggtcgtgctcatccgtacatatgcccggcaggcttctggacgattggctacggccacctc
tgtgatcccaagcacccgccgatcaccgaggccgaagccgaggtctatctggcgcgcgac
ctccaatcggcgctcgccgccacgctgcgctactgcccggtgttggccaccgaacccgag
agcaggctcgctgccatcgtggatttcacgttcaaccttggcgccggtcggctgcagacc
tcaacgctacgacgacgcatcaaccggcgggactggcccgctgccgcgactgagctgcgg
cgctgggtctatggcggcggcagggtgctgccggggcttgtcacgcggcgggaggctgag
gccacttgcctgctccgcgccgcctga

DBGET integrated database retrieval system