KEGG   Desulfovibrio alaskensis: Dde_3478Help
Entry
Dde_3478          CDS       T00294                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00260  Glycine, serine and threonine metabolism
dde00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dde01100  Metabolic pathways
dde01110  Biosynthesis of secondary metabolites
dde01130  Biosynthesis of antibiotics
dde01230  Biosynthesis of amino acids
Module
dde_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dde_3478
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dde_3478
Enzymes [BR:dde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dde_3478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABB40271
JGI: Dde_3478
UniProt: Q30VM5
Position
complement(3438923..3439735)
Genome map
AA seq 270 aa AA seqDB search
MHTEHITSPADRLTMRIREANRQGRKALIPFLPAGFPDSGDFWRQLDELDAGGADVLEIG
IPFSDPCADGPVVEQASLESLARGTTLRGVLEELERRKGRYRAGIVLMGYLNPFLQYGLD
ALARDAARAGVEGFIIPDLPLEEDALCRGALAAEGLALIPLVASNTDEDRMRAYAGVAQG
YVYVVSVMGTTGARTDLPAGVTATLERARRCFDLPLALGFGVREPEQLAACGDRLDAVIF
GSALISHIRTQGSAASFMERWRRPVAELVL
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcatacagaacatatcacaagccccgcagacaggctgaccatgcgtatccgcgaggcc
aaccgtcagggccgcaaggctcttatcccgtttcttccggcagggtttcccgattccggg
gatttctggcggcagctggacgagctggacgcgggcggtgccgatgtacttgaaataggc
attcctttttccgacccgtgcgccgacggaccggtggtggagcaggcttcgctggaaagt
ctggcccgcggaaccaccctgcgcggcgtgcttgaagagcttgaacggcgcaagggacgc
tatcgtgcaggtattgtgctgatggggtaccttaatccgtttctgcagtacgggctggat
gcgctggcgcgcgatgccgcccgtgccggggttgaagggttcatcattcccgacctgccg
ctagaagaggatgccctgtgccgcggggcgcttgcggctgaggggctggcgctgattccg
ctggtggcatccaataccgatgaagaccgtatgcgtgcctatgccggagtggcgcagggc
tatgtctatgtggtttcggttatgggtaccaccggtgcccgtaccgacctgcctgcgggg
gttaccgccacgctggaacgcgcccgccggtgctttgacctgccgctggcgctggggttc
ggcgtccgtgaaccggaacagctggcagcctgcggcgacagactggatgctgtgattttc
ggcagtgcgcttatcagccacatccgcacacagggcagtgctgcttcatttatggaacgc
tggcgccggcctgtggcagaactggtgctctga

DBGET integrated database retrieval system