KEGG   Desulfovibrio alaskensis: Dde_3479Help
Entry
Dde_3479          CDS       T00294                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dde  Desulfovibrio alaskensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dde_3479
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dde_3479
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dde_3479
Enzymes [BR:dde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dde_3479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3439750..3440913)
Genome map
AA seq 387 aa AA seqDB search
MKKGYFGDFGGQFVPELLMPPLKELENALETVVPSPEFQNEFHMLLREYVGRETPLTLCR
RLSAELGFNLWLKREDLAHSGSHKINNTLGQALLTKHMGKPAMLAETGAGQHGVATATAA
AALGLECVVFMGAVDVERQALNVERMRLLGAEVVPVQSGTRTLKDAINEAMRFWIANIAT
HHYCFGTAAGPHPFPTLVRDLQSVIGREARRQILEKTGRLPHMVVACVGGGSNAIGAFHA
FIPDGQVQLVGVEAAGSGEPGCYNSAPINLGTPGVLHGNHTMLLQSADGQILPSHSVAAG
LDYPGVGPEHAALGRSGRARYGMVNDAQALHAFKTLSRMEGIIPALESSHAVAWVLENRD
GIPRGADVVVNLSGRGDKDMGIINNLL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagggtattttggtgatttcggcgggcagtttgtacccgaactgctcatgccg
ccgctgaaggaattggaaaatgcgctggaaaccgtggtgccttcacctgagtttcagaat
gagttccacatgctgctgcgcgaatatgtgggccgcgaaacgccgctcaccctgtgccgc
aggctgtctgccgagctcgggttcaatctgtggctcaagcgtgaggacctggcgcacagc
ggatcgcataaaataaacaacacgctggggcaggcgctgctgacaaagcatatgggcaag
ccggccatgctggcggagacaggtgcaggtcagcatggcgtggccacggccacggccgcc
gccgctctggggctggaatgtgtggtctttatgggcgccgtggacgtggagcgtcaggcg
ctcaatgtggaacgcatgcgcctgctgggggccgaggtggtgcccgtgcagagcggcacc
cgcaccctcaaggatgccatcaacgaagccatgcgtttctggatagccaatattgccacg
caccattactgcttcggcacggcggcggggccgcatccttttcccacgctggtgcgcgac
ctgcagtccgtcatagggcgcgaggcacgcaggcagattctggaaaaaacaggcaggctg
ccccatatggtggtggcatgcgtgggcggcggttccaacgccatcggcgcattccatgcc
tttattcccgacgggcaggtacagcttgtgggggttgaggctgcaggcagcggagaaccg
ggctgctacaattctgcgcccatcaatctgggtactcccggcgtgctgcacggcaaccat
accatgctgctgcagagtgccgacgggcagatacttccctcgcattcggttgctgccgga
ctggactaccccggcgtggggccggaacatgcagctctgggccgcagcggcagagcgcgg
tacggcatggtgaacgatgcgcaggcgctgcatgcgtttaaaacgctttcgcgcatggag
ggcatcataccggcgctggaaagctcgcacgccgtggcgtgggtgctggaaaaccgcgac
gggattccccgcggggccgatgtggtcgtcaacctgtccggtcgtggcgacaaggacatg
ggcatcatcaacaacctgctgtaa

DBGET integrated database retrieval system