KEGG   Desulfovibrio alaskensis: Dde_3481Help
Entry
Dde_3481          CDS       T00294                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dde01100  Metabolic pathways
dde01110  Biosynthesis of secondary metabolites
dde01130  Biosynthesis of antibiotics
dde01230  Biosynthesis of amino acids
Module
dde_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dde_3481
Enzymes [BR:dde01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Dde_3481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C YscJ_FliF
Motif
Other DBs
NCBI-ProteinID: ABB40274
JGI: Dde_3481
UniProt: Q30VM2
Position
complement(3441665..3442426)
Genome map
AA seq 253 aa AA seqDB search
MLSRFAAAKEAEIAVLCARERAGTLPQAYRGARPVFSQALRRPGLVTIAEYKRASPSKGD
IAPELTPEQVAAAYAGAGAGALSVLTEETYFRGSLGYLERMAFCGLPMLRKDFILHPLQV
VQTAATPASALLLVVRMLEGADGVRRLIEAAHEKSLEAVVEVFDEQDLEIARKAGARIIQ
VNNRDLSTLRTSLAISGRLVKERDAAECWISASGITGTNHRKYVEALGFDAMLVGTVLMS
GGDPAGNLVRLLQ
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcttagccgttttgccgcagcaaaggaggccgaaattgcagtgctgtgcgcccgggaa
cgggccggtacgctgccgcaggcgtaccggggtgcccgtccggtgttttcgcaggcgctg
cggcgtcccggactggtgaccattgcagaatacaaacgggcatcaccttcaaagggcgac
atagcaccggaactgacaccggaacaggtggcggcggcgtatgccggtgccggtgcggga
gctctttccgtcctgacggaggaaacctatttccggggcagtctgggctatctggaacgc
atggcattttgcggactgcccatgttgcgcaaggatttcatactgcacccgctgcaggtg
gtgcagacggcggcgactcctgcgtcggcgctgctgctggtggtacgcatgctggagggt
gcagacggtgtgcggcgtcttatagaggcggcccatgaaaaaagtctggaggccgtagtg
gaggtttttgacgagcaagatcttgaaatagcgcgcaaagctggcgcgcggataatacag
gtgaataacagggacctgtccacgttgcgcacgagccttgccatttccggcaggttggtt
aaggaacgggatgcggccgaatgctggatttcggcaagcggcatcaccggaaccaaccac
aggaagtatgtcgaggcgctggggtttgacgccatgcttgtgggcactgtgctcatgagc
gggggcgaccccgcgggaaacctcgtcaggcttctgcaatag

DBGET integrated database retrieval system