KEGG   Desulfovibrio alaskensis: Dde_3569Help
Entry
Dde_3569          CDS       T00294                                 

Definition
(GenBank) Uncharacterized protein family UPF0066
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00051  Fructose and mannose metabolism
dde01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Dde_3569
Enzymes [BR:dde01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Dde_3569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II UPF0066
Motif
Other DBs
NCBI-ProteinID: ABB40362
JGI: Dde_3569
UniProt: Q30VD4
Position
complement(3525105..3526103)
Genome map
AA seq 332 aa AA seqDB search
MTAELRFIGVVRSSLKDIGDCPKQGDEGGVEAWVDIHEEYRAGLDSLRAGQGLTLLTWLH
EADRSVLSVHPRGDTGRPRRGVFNTRSPARPNPVGLHEVRLTAVEDGRLKVAPLEALDGT
PVIDIKTSFDQRSGTGGAASHAAPQGAAAVLRHACRTAWERGLLSGFNGNISLRIDSDTC
LVTCTGSVKGDLHAEDTALVRIDSGERLAGGVPSSETAMHLAIYRSQPQAQAVVHTHPPC
LLALGIRVAADELLRIPVYESDLIRRRMTSVPAHAPGSQELAQAAGEAARTHEAVYMERH
GLVCWAGTVRQALALSEEIEHLAGMHLHASGI
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacggcagaactgcgctttataggtgttgtccgttcttctcttaaagatatcggcgat
tgccccaaacagggggatgaaggcggcgtggaggcatgggtggacatccatgaagagtac
cgcgccggacttgattcgctgcgggcggggcaggggctgacgctgctcacatggctgcac
gaggccgacaggtcggttctttccgttcatccgagaggcgataccggtcgtccgcggcgc
ggggtgttcaatacccgttcgcctgcacggcccaaccctgtggggctgcacgaggtacgc
ctgacggcagtggaagacggcaggctgaaagtcgccccgctggaagcgctggacggtacg
cctgtcattgatatcaaaacaagttttgaccagcgcagcggtactggcggcgcagcgtcg
catgccgcgccgcagggggcagccgccgtgctgcggcatgcctgccgcaccgcgtgggag
cgcggactgctttccggttttaacggcaacatcagtctgcgcattgacagcgacacctgt
cttgtgacctgtaccggctctgtaaagggcgatctgcatgccgaagatacggcgctggta
cgtatagattccggcgaacggctggcgggaggcgtaccttcttcggagacggccatgcat
ctggccatctaccgcagccagccgcaggcgcaggcggtggtgcacacgcatccgccctgc
ctgctggcgctgggcatccgcgtggcagcggacgaactgctgcgtattccggtgtacgag
tcggacctgatacgcaggcgcatgacatccgttcccgcgcatgcaccgggctctcaggaa
ctggcacaggcagcgggtgaggctgcgcggacgcacgaagcggtgtacatggagcggcac
ggactggtgtgctgggccggtaccgtgcgtcaggcgctggcgctgagtgaagaaatagag
catcttgccggaatgcacctgcatgcgtcaggcatatag

DBGET integrated database retrieval system