KEGG   Desulfovibrio alaskensis: Dde_3696Help
Entry
Dde_3696          CDS       T00294                                 

Definition
polysaccharide biosynthesis domain-containing protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
dde  Desulfovibrio alaskensis
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Dde_3696
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dde_3696
Enzymes [BR:dde01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Dde_3696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
3658115..3658636
Genome map
AA seq 173 aa AA seqDB search
MDIMLNTADISAAAILLPVEGAQLSELRQIPAEGGPVLHMLRLDSPQFSQFGEIYFSEVL
PRRVKAWKRHSLMTQLFAVPVGCIHVVLYDGREKSPTSGRLAQVTLGRPDNYRLLRIPPQ
VWYGFAATGDTPALVANCTDIPHRQGESERAPQDAPFIPFSWAGADLSGTPVM
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
gtggacatcatgctgaacaccgcagatataagcgcagcagccatactgctgcccgtcgag
ggggcgcagctttccgagctgcgtcagataccggctgaaggcggccccgtgctgcacatg
ctgcgtctggactctccccagttttcacagttcggggaaatatatttttccgaagtgctg
ccccgccgcgtaaaagcgtggaaacggcacagcctcatgactcagctgttcgccgttccc
gtgggctgcattcatgttgttctgtacgacggcagagaaaaatcgcccaccagcggaagg
ctggcacaggtcacgctgggcagaccggacaactaccgcctgctgcgcatcccgccgcag
gtctggtacgggtttgccgccacaggcgacactccggcactggtggccaactgcacagac
attccgcacagacagggagaatcggaacgcgccccgcaggacgcgccgttcattcctttc
agctgggccggagcagacctttccggcacgccggtcatgtaa

DBGET integrated database retrieval system