KEGG   Deferribacter desulfuricans SSM1: DEFDS_0078Help
Entry
DEFDS_0078        CDS       T01188                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ddf  Deferribacter desulfuricans SSM1
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ddf00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(86477..88318)
Genome map
AA seq 613 aa AA seqDB search
MSKKFDPSKFHLLEADYSKPLLEIPIELKKKIINRLTILYDSFKAKKWYPEVERIMKVYY
AHKTDTMKEWEKRFNPKDRFTEKDVVLITYGDIIKNRYKKPIKVLSKFVKKYLKNVINTI
HLLPFYPYSSDRGFSVIDFEQVDPRIGSWEDIINLKKDFKLMFDGVFNHISSKSRWFQEF
LNGNPDYQNYFIVLSTKEMISEDHLKLILRPRTTPLFTEFDTINGKKLVWTTFSPDQIDL
NYRNPKVLIRMLDILLYYVRRGADIIRLDAVTYLWEELGTECAHLKQTHETIKLFRDILS
FVAPHVAIITETNVPHEQNIKYFGNGYDEAHMVYNFALPPLVLYTYYTKDSTKLTNWAKT
ITKVSDEATYFNFLDSHDGIGLLPAKGILDDKDIEMMVLKTLEHGGFISYRTDKDGNESP
YELNITWYSALNNEDEPEDEMIKLKRFISSRVIALSFMGVPAIYIHSLFASKNDAEAVLN
EKQTRSINRKVLSEKSLNEILRNESSHSHKALKMLINVISKRVKEKAFHPNAQQKVINID
KRVFALLREYEDSKVLVIVNITDAEFDLNINLKHYFKNNCDLVNLITEQKISYKDSNLLI
KLKPYDYLWLKGY
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaattcgatccttccaagtttcatcttttggaagcagattacagcaaacct
ctcttagaaattcccatagagcttaagaaaaaaattatcaatagactaactattctttat
gactccttcaaagccaaaaaatggtatccagaagtagaacgaataatgaaagtttattat
gcccataaaacagatacaatgaaggagtgggaaaaacggtttaacccaaaagatcgtttt
acagaaaaagatgtagtgctgataacttatggggacataataaaaaatagatacaaaaaa
ccgataaaagtattgtccaagtttgtaaaaaaatatctaaaaaatgtaattaatacaata
caccttctccctttttacccttattcatctgatagaggtttttcagttatagattttgaa
caggttgacccaagaataggtagttgggaagatattattaatcttaaaaaagatttcaag
cttatgttcgatggcgtttttaatcacatttcatcaaaaagtaggtggtttcaggagttc
ttaaatggcaatcctgactatcaaaattattttattgtgttgtcaacaaaagagatgatt
tctgaagatcatttaaaactaatattgaggccaaggacgaccccactttttacagaattt
gatacaataaatggtaaaaaactggtttggactacttttagtccagatcaaattgatcta
aattacagaaatccaaaggttttaattagaatgcttgatattttactctactacgttaga
agaggcgctgatatcataaggcttgatgcggtaacatatctgtgggaagaactgggtaca
gaatgtgcccatcttaaacaaacccatgaaacaataaaactttttagagatattttaagt
tttgtagcaccacacgtggccataattactgaaacaaatgtccctcatgaacaaaatatt
aaatattttggcaatggatatgacgaagcacatatggtatataattttgctttgccacca
ctcgttttatatacatactacacaaaagattcgacgaaacttacaaactgggcaaaaact
atcacaaaagtttctgacgaagcaacttattttaattttttagattcccatgacggaata
gggcttttgcctgctaaagggatattggatgataaagatatagaaatgatggttttaaaa
acccttgagcatggaggctttatctcatacaggactgacaaagacgggaacgagtcccct
tatgaactgaatattacatggtacagcgcattaaacaacgaagatgagccagaagatgaa
atgattaaactaaaaagatttatctcatctagagtaattgcactatcatttatgggggtt
cctgcaatatatatacacagtttattcgcatcaaaaaatgatgccgaagcagttttaaat
gaaaagcaaacaagaagtataaacaggaaagtattaagtgaaaaatcgttaaatgaaatt
ttaagaaatgaaagtagccatagtcataaggcattgaaaatgcttattaatgttatatct
aaaagagttaaagaaaaagcattccatccaaacgcacagcaaaaagttataaacatagat
aaaagagtttttgcattactaagagaatacgaagactctaaagttttagtcatagtaaac
atcacagatgctgaatttgacctaaatattaatttaaaacattattttaaaaacaactgc
gatctcgtaaatttgattactgagcaaaagataagctataaagattctaatttattaata
aaactaaaaccttacgattatttatggttaaagggatattag

DBGET integrated database retrieval system