KEGG   Deferribacter desulfuricans: DEFDS_0090Help
Entry
DEFDS_0090        CDS       T01188                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ddf  Deferribacter desulfuricans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ddf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DEFDS_0090 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DEFDS_0090 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DEFDS_0090 (thrC)
Enzymes [BR:ddf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DEFDS_0090 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
101246..102640
Genome map
AA seq 464 aa AA seqDB search
MKYKSTRGDVNSITFKDAVLMGLADDGGLLIPEELPQISNEELMSLKDKSYQDVAFYIMN
KYIDDIKEDVLKKLIDKSYKNFDTDKVVPLIDLDDFYLLELFHGPTLAFKDVALQFLGNL
FEYILSERKQNLNIIGATSGDTGSAAIYGVRGKKGVKIFILHPKGRVSKIQELQMTTVLD
KNVFNIAVEGTFDDCQFIVKEIFSDVDFKKKYNLGSINSINWARVLSQIVYYFYAYLQTK
ESDNLDKINFIVPTGNFGNVLAGFYAKKMGLPVNKLVIATNENNILHRFVQKGDYSIKGV
VKTYSPSMDIQIASNFERYLYYLYDGDHQKVKGSMAALKNDKFIKFNDLEIEKVHQDFDS
TTTTNEETLNIIKTVYERNNYIVDPHTACGVDGALKLKDKLDEKFICLATAHPAKFLDAV
KVAIGKEPEIPERIKELFNKDKRVYEMPNDVNAIKSFIEQNIDE
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaagtataaaagtacaagaggggatgtaaacagtattacttttaaagatgctgtatta
atggggcttgctgatgatggtgggttactaattccagaggagcttcctcaaatttcaaat
gaagaacttatgtctctaaaagataaaagttatcaagatgtagctttttatattatgaat
aaatatatcgatgatatcaaagaggatgttttaaaaaagttgattgataaaagttataaa
aatttcgatactgataaagtggttcctctaatagatcttgatgatttttatcttttagag
ctttttcatgggccaacgcttgcttttaaagacgttgctttacagtttttaggcaatttg
tttgaatatatattatctgaaagaaaacaaaaccttaatataattggagcgacaagtggt
gatactggtagtgctgcaatatatggtgtaagaggtaaaaaaggggttaaaatttttatt
ttgcatcctaaagggcgtgtaagtaaaatccaagagcttcaaatgacaactgtgcttgat
aaaaatgtttttaatattgcagttgaagggacttttgatgattgtcagtttattgtaaaa
gagattttttctgatgtagattttaagaaaaaatataatttgggttcgataaattctata
aattgggcaagggtcctatctcaaatagtttattatttttatgcttatttgcaaacaaaa
gagagtgataatttagataaaattaattttattgttccgacaggaaactttggaaatgtt
cttgcaggtttttatgcaaagaaaatggggttacctgtaaataaacttgtaattgctaca
aatgagaataacatcttgcatcgatttgttcaaaaaggggattatagtataaaaggtgtt
gttaaaacatactccccttcaatggatattcagattgctagtaattttgaacgatatctt
tattatctttacgatggagatcatcaaaaggtaaagggatcgatggctgcattgaaaaat
gataaatttataaaatttaacgatttagagattgaaaaagtacatcaagattttgactca
acaacgacaacaaatgaggaaacgttaaatattataaaaactgtttatgaaagaaataat
tatattgtagacccacatactgcttgtggagtggatggagcattaaagttaaaagataaa
cttgatgaaaaatttatttgtcttgctacggctcatccagccaagtttttagatgcagta
aaagttgcaattgggaaagaacctgaaatccctgagcgtataaaagagctgtttaataaa
gataagagagtgtatgagatgccaaatgatgttaatgctataaaaagttttattgagcaa
aatatagatgagtaa

DBGET integrated database retrieval system