KEGG   Deferribacter desulfuricans: DEFDS_0129Help
Entry
DEFDS_0129        CDS       T01188                                 

Gene name
tpiA
Definition
(RefSeq) triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ddf  Deferribacter desulfuricans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ddf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DEFDS_0129 (tpiA)
   01230 Biosynthesis of amino acids
    DEFDS_0129 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEFDS_0129 (tpiA)
   00051 Fructose and mannose metabolism
    DEFDS_0129 (tpiA)
   00562 Inositol phosphate metabolism
    DEFDS_0129 (tpiA)
Enzymes [BR:ddf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DEFDS_0129 (tpiA)
Exosome [BR:ddf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DEFDS_0129 (tpiA)
  Exosomal proteins of bladder cancer cells
   DEFDS_0129 (tpiA)
  Exosomal proteins of melanoma cells
   DEFDS_0129 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
137102..137854
Genome map
AA seq 250 aa AA seqDB search
MRKPLIVGNWKMNTTISEGVELVKSVIDSGVDQLSVDFGFAPPFISIYEIKKYLNDSHIL
AGQNMYFEDSGAYTGEISADMLLGAGCNYVILGHSERRHIFGETDEVINKKVLHALKKGL
NVILCVGELLEEREAGCEVETVLRQVGLGLKSVEKGLINNVVIAYEPVWAIGTGKTASKD
DAEKMHMEIRKYIAKLYDDDVAQRIRIMYGGSVKPENIKELMSSPEIDGALVGGASLKAE
SFIKILKYYE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagcctttgatcgttggtaattggaaaatgaataccactatttcagagggcgtt
gagcttgtgaaatctgttattgatagtggtgtggatcaattaagtgtggattttggtttt
gcaccaccatttatctctatatatgaaatcaagaaatatttaaatgatagccatatctta
gctggtcagaatatgtattttgaagattctggtgcgtatactggagaaatttctgctgat
atgcttttaggtgctgggtgtaattatgttattttaggacactctgaaagaagacatatt
tttggggaaacagatgaggtaataaataaaaaagtattacacgcactaaaaaaaggatta
aatgttattttatgtgtgggtgagcttttagaagagagagaagctggttgtgaggttgag
acagttttaaggcaagttggtttgggattaaaaagtgttgaaaaagggttgattaataat
gttgtaattgcttatgagcctgtatgggcaatagggacaggaaaaacagcctcgaaagac
gatgctgaaaagatgcatatggaaattagaaaatatatagctaagctttatgacgatgat
gtagctcaacgtattagaataatgtatggtggaagcgtcaaaccagagaatattaaagaa
ttgatgagttcaccagagatagatggtgctttagttggtggtgcaagcttaaaagctgaa
tcttttataaaaattttaaaatattatgaataa

DBGET integrated database retrieval system