KEGG   Deferribacter desulfuricans: DEFDS_0143Help
Entry
DEFDS_0143        CDS       T01188                                 

Gene name
recR
Definition
DNA recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ddf  Deferribacter desulfuricans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DEFDS_0143 (recR)
DNA repair and recombination proteins [BR:ddf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      DEFDS_0143 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
150658..151257
Genome map
AA seq 199 aa AA seqDB search
MIKLADFERCVFELSKLPGIGKKTATRLALHLLKMTNKDVESLVNSINKLKTNIKFCKEC
GSLTDKDICYVCLDEGRDRKTICVVEEAKDVIIIENSGIYKGLYHVLGGRIAPLDGITPD
MLSFEKLLNRVGDLGVTEVIIATNPDVDGETTAYYLKKLLADYDIRITRIASGLAVGTHI
EYSDEFAILKALENRVELK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgattaaattagctgattttgaaagatgtgtatttgaattaagtaagctgcctgggatt
gggaaaaaaacggccactaggctggctttacatcttttaaaaatgacaaataaagatgtt
gagtcgcttgttaacagtattaataagttgaaaactaatattaaattttgcaaagagtgt
ggttcgctgactgataaagatatatgttatgtatgtttagatgaaggtagagatagaaaa
actatctgtgtagttgaagaagcaaaagatgtaatcattatagaaaatagtgggatttat
aaggggctatatcatgtgttgggggggagaatagcacctcttgatggtattactccagat
atgttgagttttgagaagttattaaatagggttggggatttgggtgtaacagaagtaatt
atagcaactaatccagatgttgatggtgaaactactgcatattatttaaaaaaattgctt
gctgattacgacatcagaattactaggattgcatctggtctggccgttggcacacatata
gaatattctgatgaatttgctattttaaaagctttagaaaatagagtagagctaaaatag

DBGET integrated database retrieval system