KEGG   Deferribacter desulfuricans SSM1: DEFDS_0260Help
Entry
DEFDS_0260        CDS       T01188                                 

Definition
protein-L-isoaspartate (D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ddf  Deferribacter desulfuricans SSM1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(263221..263820)
Genome map
AA seq 199 aa AA seqDB search
MRIPEYFLKEIIAPACNNERIVEAFKKVPRHLFIDDALIKLAYKDDALPIGYGQTISKPS
TVAKMTAILDPQPNDKVLEIGTGSGFQAAILSKLVSEVYTVERIPALYRRATTIIRKLYI
HNVKFKIDNGKVGWEEYAPYDKIIVTAGAELLPEELLNQLKDGGRLVIPINNTLKLYIKE
SNKLIKKNISECKFVKFVF
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcccagaatattttctaaaagaaataattgctcctgcctgtaataacgagcga
attgtagaagcctttaaaaaagtcccaagacatcttttcatagatgatgctttaataaaa
ctagcttataaagatgatgctctcccaataggttatggtcagacaatttcaaagccatca
actgtagctaaaatgacagctattttagatccacaacctaatgacaaagttttggaaata
ggcacaggttctggatttcaagcagctatcctttctaaactcgtttcagaagtttatact
gtagaaaggatcccagcattatacagaagggcaacaacaatcattagaaagctttatata
cataatgtaaagtttaaaatagataacggtaaagttggctgggaagaatacgccccttat
gataaaatcattgtcaccgctggagctgaattattacctgaagagttgctaaatcaatta
aaagatggtggtagattagttatcccaataaataatactttaaaattatatataaaagag
agtaacaaacttattaaaaaaaatatttctgaatgtaagttcgtcaaatttgttttttaa

DBGET integrated database retrieval system