KEGG   Deferribacter desulfuricans: DEFDS_0443Help
Entry
DEFDS_0443        CDS       T01188                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ddf  Deferribacter desulfuricans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ddf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DEFDS_0443 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DEFDS_0443 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DEFDS_0443 (trpB)
Enzymes [BR:ddf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DEFDS_0443 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
427280..428455
Genome map
AA seq 391 aa AA seqDB search
MNYNRYFYGEYGGQFVAETLIPLLDELEENFIKYKDNKNFNDELDYLLKNYAGRPTPVYF
AKRLSEKYGVNIYLKREDLLHTGAHKINNTLGQALLAKYMGKKRIIAETGAGQHGVATAT
VCALLGIECTVYMGSLDAKRQRINVERMKMLGAKVEVVDFGSQTLKDAVSAAIKDWVTNV
DTTHYLIGSAVGPYPFPEIVAHFQSVIGLEARKFFIEEVGKLPDVVVACVGGGSNAIGIF
RGFLEDEDVRLIGVEAGGLSEKVGEHASSISYGKKGVFQGSLSKVLQTEFGQIASVHSVS
AGLDYPGVGPEHAYLFDIGRAEYYPINDKEAVDGFFELTRLEGILPALESSHAIGYVMKH
HKEFIGKNVLINLSGRGDKDLHIIEDYVRGI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaattataatagatatttttatggggagtatggtggccaatttgtagcggaaactctt
ataccgctcctcgatgaacttgaagaaaattttattaaatacaaagataataaaaatttt
aatgatgaattagattatttgttaaaaaattatgcaggcagaccaacacctgtttatttt
gcaaagagattatctgaaaagtatggagttaatatttatctaaaaagggaagatttactt
catacaggagctcataaaataaataacactttagggcaggcgttgcttgcaaaatacatg
gggaaaaagcgtattattgctgagacaggagctggacagcatggagttgccactgcaaca
gtttgtgctttacttgggattgaatgtacagtgtatatggggagtcttgatgctaaaaga
cagagaataaatgtagagcggatgaagatgcttggtgcaaaagtggaagtggtagatttt
ggtagtcaaactttgaaagatgctgtaagtgcagcaataaaagattgggtaaccaatgtt
gatactactcattatctcattggctctgcagttgggccatacccttttccagaaatcgtg
gcacattttcagtcagtaattggattagaagcaagaaagtttttcattgaagaggttggt
aaattgcctgatgttgttgttgcctgtgttggcggaggaagtaatgcgataggtattttt
agaggttttttagaggatgaagatgtaagattgattggtgtagaagcgggtggtttatca
gaaaaggttggggagcacgcaagtagtatctcttatggcaaaaaaggggtttttcagggg
agtctttcaaaggtattgcaaacagaatttgggcagattgcaagtgtccattctgtatct
gctggacttgattatccaggcgttgggcctgagcatgcctatctatttgatataggtaga
gcagaatattatccaataaatgataaagaagcagtagatggtttctttgaacttacaagg
ttagaagggattttaccagctttagaatctagtcatgcaatagggtatgtgatgaagcat
cataaagagtttattggtaaaaatgtgttaatcaatttgtcggggagaggggataaggat
ttgcatattatagaagattatgtgaggggaatatga

DBGET integrated database retrieval system