KEGG   Deferribacter desulfuricans: DEFDS_0444Help
Entry
DEFDS_0444        CDS       T01188                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ddf  Deferribacter desulfuricans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ddf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DEFDS_0444 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DEFDS_0444 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DEFDS_0444 (trpA)
Enzymes [BR:ddf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DEFDS_0444 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
428452..429144
Genome map
AA seq 230 aa AA seqDB search
MKGVYIVLSYPDKETFLEVINFISNYDGIDFIEIGYPFNDPVADGPVIMDAINQVYDKVT
FEDLKEVLRIINKRKKVYVMTYSNIVYSYGLKQFSDDFGFLLDGLIIADLPNRMHDFFYQ
KGLSVEIIPFLTPTSRKEDILSINNLKGDFVYYVGTKGTTGVMGDLNFNENKISDIKKLV
NKKVVYGFGIKTRDDIYDILKFSDGVVVGTEIVKRQKDFEKFKSFIKNTF
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtgtttatattgttctaagctatccagataaagaaacatttcttgaagtaata
aattttatatcgaactatgacggtatagattttatagagataggttacccttttaatgat
ccagttgctgatgggccggttataatggatgcaatcaatcaggtttatgataaagttact
tttgaagatttaaaagaggtattgaggataataaataaaagaaaaaaagtatatgtaatg
acatattcaaatattgtttatagctatggattaaaacagttttctgatgattttggtttt
ttactagatggtcttataattgccgatttgccaaataggatgcatgactttttttatcaa
aaaggtttatctgtagagattattccctttttaacaccaacgagtagaaaggaagatatt
ttatcaattaacaatttgaaaggtgattttgtatactatgttgggacaaaggggacaact
ggggttatgggtgacttaaattttaatgaaaataagattagtgatataaaaaagttggtg
aataaaaaagtagtttacggatttggcattaagacaagagatgatatatatgatatttta
aaattttctgacggtgtagtggtaggaacagaaatagtaaaaagacaaaaagattttgaa
aaattcaagagttttatcaaaaatacgttttga

DBGET integrated database retrieval system