KEGG   Deferribacter desulfuricans: DEFDS_0687Help
Entry
DEFDS_0687        CDS       T01188                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ddf  Deferribacter desulfuricans
Pathway
ddf00020  Citrate cycle (TCA cycle)
ddf00190  Oxidative phosphorylation
ddf00650  Butanoate metabolism
ddf01100  Metabolic pathways
ddf01110  Biosynthesis of secondary metabolites
ddf01120  Microbial metabolism in diverse environments
ddf01130  Biosynthesis of antibiotics
ddf01200  Carbon metabolism
Module
ddf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ddf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ddf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ddf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DEFDS_0687 (sdhD)
   00650 Butanoate metabolism
    DEFDS_0687 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    DEFDS_0687 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt YbgT_YccB
Motif
Other DBs
NCBI-ProteinID: BAI80167
UniProt: D3PC44
Position
complement(665871..666188)
Genome map
AA seq 105 aa AA seqDB search
MKYYKFMGSSDRGVFEWLMQRISGVILILVIFIHFFSMIKSGEWGLKKIVLGPLFAFGIF
HTLNGFKMITDDYVSNPTWRAIILAIYWIVGVTLAILALSVVSSL
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattataagtttatgggttcaagcgacagaggtgtatttgaatggttaatgcaa
aggatttctggtgttatcttaatccttgtaatttttatacactttttctcaatgattaaa
agcggtgaatggggtttgaaaaagatagtattgggaccacttttcgcttttggtatattc
catacgttaaacggcttcaaaatgattactgatgactacgtatctaacccaacatggaga
gcaattattcttgcaatttactggatcgttggtgttactttagctatacttgcattatca
gtagtttcatcattataa

DBGET integrated database retrieval system