KEGG   Deferribacter desulfuricans SSM1: DEFDS_0738Help
Entry
DEFDS_0738        CDS       T01188                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ddf  Deferribacter desulfuricans SSM1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ddf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
722671..724383
Genome map
AA seq 570 aa AA seqDB search
MMVLDILLKNKIIGYFEYEVAKWVYENTKNPLIKNIFLLLAYSYENGDSCLDLKCIENRD
LLEFFELDDKGLSFIFPDSEKIKSEIVKYNFLKNLVVVFDDKLFFKRIFNYEKYIADKIR
ELSAKKRGIKKFFYDENLNNLQNLAVSLSVINNFMVISGGPGTGKTTVIKKIIETILDNN
DNHKIAITAPTGKAVSRILESLKEFPFLDKIEPPCTIHRLLGANSREMRFYYNKNNRLPF
DTLIIDEVSMVDVEIFYHVLQALKDDARLILIGDKNQLSSVEAGAVLGEICSIKEFFGLN
TLNFFTKNIANKFDFNGNVVENDSMPIVDCLIEFDESYRFGKNSGISRLAELIKFEKYNE
LEELIFSERGFDGLLFYDLNKNVIENIVDDFKKEIKENYLQALNKIKILTPFKRGDFGTE
FLNFYVDKKLKKSFGATDWYTGRQLIINKNDYSNGLYNGDMGVAVVEDKKYLMFYDSLNK
EYLKFPESLISGYDLGFALTVHKSQGSEFDNVYFILGNKDHQMLTKELIYTAITRAKKRV
IIIGDKQILFNAIKRKTDRKSAIGKLLYES
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgatggtattagatattttacttaaaaacaaaattataggttattttgagtatgaagtt
gctaaatgggtatatgagaatacaaaaaatccgctaattaaaaatatttttttattatta
gcatatagctatgaaaatggggatagttgtcttgatttgaagtgtattgaaaaccgtgat
ttgttagaattttttgaattagatgataaaggattaagctttatttttccagatagtgaa
aagataaaatcagaaattgtaaagtataactttttgaaaaacttggtagtggtttttgat
gataaactattttttaaaaggatttttaattatgaaaaatatattgcagataaaatcaga
gaattatcagcgaaaaaaagaggaataaaaaagtttttttatgatgagaacttaaataac
ttacaaaatcttgctgtaagtctttctgtaataaacaattttatggtaatatcagggggg
cctgggactggtaagaccactgtaatcaaaaagataatcgagacaattttagataataat
gataatcataaaattgctataacagcacctactggaaaagcagtatcaaggattttagaa
tcattaaaagagttcccttttcttgataaaattgagcctccttgtactattcatagactt
cttggtgctaatagcagagagatgcgtttttattataacaaaaataacagattacctttt
gatactttaattatcgatgaagtttcaatggttgatgtggaaatattttatcacgtttta
caggcattaaaggatgatgctcgtttgatattaattggggataaaaatcaactctcttcg
gttgaggctggagcagtacttggggagatttgtagtataaaagagttttttgggttaaat
accttaaatttttttacgaagaatatagcaaataaatttgattttaatggtaatgttgtg
gaaaatgattctatgccaattgttgactgtttaattgaatttgacgaaagttatagattt
ggaaaaaatagcggaataagcagattggctgagttaataaaatttgagaaatataatgaa
ttagaagaactaatttttagtgaaagaggttttgatggcctgttgttttatgatttaaat
aaaaatgtgattgagaatatcgttgacgattttaaaaaagagataaaagagaattacctt
caggctttgaacaaaatcaaaattttaactccatttaaaagaggggattttgggacagaa
tttctaaatttttatgtggataaaaaattaaaaaaaagctttggtgcaacagattggtat
acgggtagacagctcataataaataaaaatgattattcaaatgggttgtataatggtgat
atgggtgtggcagtggtagaggataaaaaatatttgatgttttatgattcattgaataaa
gagtatttaaagtttccagagtcattgataagtggttatgatttgggttttgctttgaca
gtgcacaaaagtcaaggttcagaatttgataatgtttattttattttagggaataaagac
catcaaatgttaacaaaagagctgatttacactgcaattacgagagctaaaaaaagggta
attataattggagataaacagatattgtttaatgctatcaaacgaaagactgatagaaag
tctgctataggcaagttactttatgagtcataa

DBGET integrated database retrieval system