KEGG   Deferribacter desulfuricans: DEFDS_0812Help
Entry
DEFDS_0812        CDS       T01188                                 

Gene name
hemB
Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ddf  Deferribacter desulfuricans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DEFDS_0812 (hemB)
Enzymes [BR:ddf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     DEFDS_0812 (hemB)
Exosome [BR:ddf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DEFDS_0812 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
810700..811665
Genome map
AA seq 321 aa AA seqDB search
MSFPLIRGRRLRRNETIRRMVRETKLSVDDLIYPLFVVEGENIKNEIKSMPGNYQMSIDN
IVKECIEIEKLGIPAVILFGIPELKDELGSEAYNDEGIIQKAIKAIKENTSKLYVITDVC
MCEYTSHGHCGIIRDGDVDNDETLKYLALEALSHAKAGADMVAPSDMMDGRVAAIRDILD
EHGYYNIPIMSYAVKYASSFYGPFREAAESTPAFGDRRSYQMDPPNRLEALREAEMDIME
GADIIMVKPALPYLDIIREVKDNFNVPVAAYNVSGEYSMIKAAIEKGWLDEKVIFESLIS
IKRAGADLILTYFAKEIAEKL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttccattaattagaggtagaaggttgaggagaaatgaaaccattcgcagaatg
gtaagagaaacaaaattatcagtagatgatttgatatatccattatttgtagtagaaggt
gaaaatatcaaaaatgagattaaatctatgcctggaaattatcaaatgagtatagataat
attgtaaaggagtgtatagagatagaaaaattagggatacctgccgttattctctttggg
ataccagaacttaaagatgaattgggaagtgaagcatataatgatgaaggtattattcaa
aaagcaattaaagcaataaaagaaaatacaagtaaactttatgtgattaccgatgtttgt
atgtgcgaatatacgagtcatggacattgtggaataattagagatggtgatgtggataat
gatgaaactctaaaatatcttgcccttgaagctttgagccatgctaaagccggcgcagat
atggtggcaccaagcgatatgatggatggtagggtagcagctatacgtgatattttggat
gaacatggttattataatattccaataatgagttatgcggttaaatatgcttcatcattt
tatggtccttttagagaagctgctgaaagtacccctgcttttggagacagaagatcatat
caaatggatcctcctaacaggcttgaggctttgagagaagctgaaatggatattatggaa
ggtgcagatataattatggtaaaacctgctttgccttatttggatataattcgtgaagta
aaagataattttaatgttcctgttgctgcatataatgtaagtggagaatattctatgata
aaagctgctatagagaaagggtggcttgatgagaaggtaatttttgaatcactgatttct
ataaaaagagctggagcagatttaatattaacctatttcgcaaaagagatagcggagaaa
ttataa

DBGET integrated database retrieval system