KEGG   Deferribacter desulfuricans: DEFDS_0940Help
Entry
DEFDS_0940        CDS       T01188                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ddf  Deferribacter desulfuricans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ddf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DEFDS_0940
   01230 Biosynthesis of amino acids
    DEFDS_0940
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEFDS_0940
   00030 Pentose phosphate pathway
    DEFDS_0940
   00051 Fructose and mannose metabolism
    DEFDS_0940
   00052 Galactose metabolism
    DEFDS_0940
  Energy metabolism
   00680 Methane metabolism
    DEFDS_0940
Enzymes [BR:ddf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DEFDS_0940
Protein phosphatases and associated proteins [BR:ddf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DEFDS_0940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
940676..941641
Genome map
AA seq 321 aa AA seqDB search
MKRIAVLTSGGDCPGMNAAIRSVVRTALSKGIEVYGIEQGYKGLIEGEFRKLESKDVANI
IQKGGTFLRSARSERFKTEEGQKEAIKNLEKHNIDGLVVIGGDGSLRGATVLCGKYGVNV
IGIPGSIDNDIYGTDMSIGVDTALNTIVRCIDSINDTASSHDRTFLIEVMGRNCGYLALM
SAIAGGAEAVLIPEVPYNIEKIIEKIKKRYEEGKTRSIVIVAEGVGSAYDFGKVFGMIGG
FETRITVLGHLQRGGSPTVFDRTLATRMGAFAVETLLDGTGCGKMVALQKTKMELVDLND
VLNKKKELDPKLLEIAEILSN
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattgctgtattaacaagtggtggtgattgtccaggtatgaatgcggctata
agaagtgttgtgcgtacggcattgagcaaaggtatagaagtgtatggtatagagcaaggg
tataagggtttaatagaaggagagtttagaaaacttgagagcaaggatgtcgcaaacatt
attcaaaaaggtgggacttttttaagaagtgccagaagtgaaagattcaaaaccgaagag
gggcaaaaggaagctattaaaaaccttgaaaaacataatattgatgggcttgtggttata
ggcggggatggttcccttagaggtgctactgtactttgtggtaaatatggtgtgaatgtg
attgggatacctggttccattgataatgatatatacggcactgatatgtctataggagtg
gatacagcgttaaatacgattgttcgttgtattgattctatcaatgatacagcaagttcc
catgatagaacatttcttattgaagtaatggggaggaactgtggttatttggctttaatg
tcagccattgctggtggagctgaagctgtattgattcctgaagtaccatataatattgag
aaaattattgaaaagattaaaaaaagatatgaagaagggaaaacgagaagtattgttatt
gtagcagaaggggtaggatctgcttatgattttgggaaggtttttggcatgattggtggt
tttgagacaagaattacagttttaggtcatttgcaacgaggtggtagtcctactgttttt
gatagaacgcttgcaacaaggatgggtgcatttgctgttgagactctcttggatgggaca
ggttgcggtaaaatggtagctttacagaaaactaagatggagcttgttgatttaaatgat
gttttgaataagaagaaagagcttgacccaaaattattagaaatagctgaaatattgagc
aattag

DBGET integrated database retrieval system