KEGG   Deferribacter desulfuricans SSM1: DEFDS_0940Help
Entry
DEFDS_0940        CDS       T01188                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ddf  Deferribacter desulfuricans SSM1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ddf01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ddf01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ddf00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ddf00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ddf00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ddf00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ddf00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
940676..941641
Genome map
AA seq 321 aa AA seqDB search
MKRIAVLTSGGDCPGMNAAIRSVVRTALSKGIEVYGIEQGYKGLIEGEFRKLESKDVANI
IQKGGTFLRSARSERFKTEEGQKEAIKNLEKHNIDGLVVIGGDGSLRGATVLCGKYGVNV
IGIPGSIDNDIYGTDMSIGVDTALNTIVRCIDSINDTASSHDRTFLIEVMGRNCGYLALM
SAIAGGAEAVLIPEVPYNIEKIIEKIKKRYEEGKTRSIVIVAEGVGSAYDFGKVFGMIGG
FETRITVLGHLQRGGSPTVFDRTLATRMGAFAVETLLDGTGCGKMVALQKTKMELVDLND
VLNKKKELDPKLLEIAEILSN
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattgctgtattaacaagtggtggtgattgtccaggtatgaatgcggctata
agaagtgttgtgcgtacggcattgagcaaaggtatagaagtgtatggtatagagcaaggg
tataagggtttaatagaaggagagtttagaaaacttgagagcaaggatgtcgcaaacatt
attcaaaaaggtgggacttttttaagaagtgccagaagtgaaagattcaaaaccgaagag
gggcaaaaggaagctattaaaaaccttgaaaaacataatattgatgggcttgtggttata
ggcggggatggttcccttagaggtgctactgtactttgtggtaaatatggtgtgaatgtg
attgggatacctggttccattgataatgatatatacggcactgatatgtctataggagtg
gatacagcgttaaatacgattgttcgttgtattgattctatcaatgatacagcaagttcc
catgatagaacatttcttattgaagtaatggggaggaactgtggttatttggctttaatg
tcagccattgctggtggagctgaagctgtattgattcctgaagtaccatataatattgag
aaaattattgaaaagattaaaaaaagatatgaagaagggaaaacgagaagtattgttatt
gtagcagaaggggtaggatctgcttatgattttgggaaggtttttggcatgattggtggt
tttgagacaagaattacagttttaggtcatttgcaacgaggtggtagtcctactgttttt
gatagaacgcttgcaacaaggatgggtgcatttgctgttgagactctcttggatgggaca
ggttgcggtaaaatggtagctttacagaaaactaagatggagcttgttgatttaaatgat
gttttgaataagaagaaagagcttgacccaaaattattagaaatagctgaaatattgagc
aattag

DBGET integrated database retrieval system