KEGG   Deferribacter desulfuricans: DEFDS_0967Help
Entry
DEFDS_0967        CDS       T01188                                 

Gene name
speB
Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
ddf  Deferribacter desulfuricans
Pathway
ddf00330  Arginine and proline metabolism
ddf01100  Metabolic pathways
Module
ddf_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:ddf00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    DEFDS_0967 (speB)
Enzymes [BR:ddf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     DEFDS_0967 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489 SEO_C
Motif
Other DBs
NCBI-ProteinID: BAI80439
UniProt: D3PCW6
Position
complement(964322..965152)
Genome map
AA seq 276 aa AA seqDB search
MKPISNSLIGCDKEFHDSEIIITGIPYDGTSSYRPGSRFAPDEIRKSSYGLETYSPYQNK
DLEDKKVCDIGDLELPFGEKKLILDRIETHIDNILKYNKKILSIGGEHLITLPIIKSFLK
KYKNLYLIHFDAHADLRDEYLGEKLSHATVIKNIADIIGFEKIYQYGIRSGTKEEFELIR
SKNLLNRSVDKIKQLINDNPVYITVDLDILDPSIFPGTGTPEPGGWSFNNLMNKLMKFKD
LNIVGCDVVELSPHYDHSMVSTITAAKIIREILIFI
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccatatcaaatagtttaattggatgtgataaagaatttcacgattctgaaata
atcataacaggtataccttatgacggcacaagtagttacagacctggctctcgttttgcc
ccggacgaaattcgaaaatcatcatacggattagaaacctactcaccttatcaaaacaaa
gatttagaagataaaaaagtatgtgatattggtgatttagaactcccttttggagaaaaa
aaattaattttggatagaatagaaacgcatattgataatattttgaaatataataaaaaa
atcttatcaataggtggcgagcatttaatcactctacccataatcaaaagttttttaaaa
aaatacaaaaatctttatctaattcattttgatgcccatgctgatttaagagatgaatat
ttaggagaaaaactttctcatgccactgttattaaaaatattgctgacataattggattt
gaaaaaatataccaatatggtatcagaagcggaacaaaagaagagtttgagctcataaga
agcaaaaatttgcttaatagatcagtagataaaattaaacagcttataaatgataaccct
gtatatattactgtagatttggatatactggacccttctatcttccctgggactggtaca
ccagagccaggaggatggagctttaacaaccttatgaataaattaatgaaatttaaagat
ctaaatattgtaggatgtgatgtagtggagctctctccacattatgatcattcaatggtt
tctacaattaccgccgcaaaaattataagagaaatattaatttttatttga

DBGET integrated database retrieval system